KEGG   Virgibacillus phasianinus: CFK37_13485Help
Entry
CFK37_13485       CDS       T04951                                 

Definition
(GenBank) TIGR04086 family membrane protein
Organism
vil  Virgibacillus phasianinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792 DUF1516 DUF4203 Bax1-I DUF1129
Motif
Other DBs
NCBI-ProteinID: ASK63085
UniProt: A0A220U4U7
LinkDB All DBs
Position
complement(2815639..2816019)
Genome map
AA seq 126 aa AA seqDB search
MKRQQFIALMYGWIVILGLIFISSIVLALLLKFTPLNEPTLSWVTLVIGLITLFFGGIVA
GTKSKKKGWLIGGVTGLGFTLFTFAVQYLGYQHTFSIEQSLNHLGYILIAVLGGVIGVNA
VGESQE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggcaacaatttattgctttaatgtacgggtggattgtaattcttggtcttatc
tttatttcaagtatagtattagcgcttttactcaaatttacaccattaaatgaaccgaca
ctatcgtgggtaacgcttgtaatagggctaatcacattatttttcgggggtattgtggcc
ggaacgaaaagcaagaaaaaaggctggctaatcggtggggttaccggtctcggatttact
ttattcacatttgctgtgcaatatctaggatatcagcatacattttcgattgaacaatcc
ctgaaccatctagggtacatcctgattgcggttttaggaggagtaattggagtaaacgca
gttggggaaagccaggaataa

DBGET integrated database retrieval system