KEGG   Virgibacillus phasianinus: CFK37_14005Help
Entry
CFK37_14005       CDS       T04951                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vil  Virgibacillus phasianinus
Brite
Enzymes [BR:vil01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFK37_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N MauJ
Motif
Other DBs
NCBI-ProteinID: ASK63179
UniProt: A0A220U4Z0
LinkDB All DBs
Position
2916093..2916704
Genome map
AA seq 203 aa AA seqDB search
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHSDLQDKSLNDLVA
SLDSVPQDIRTAVRNNGGGHANHSLFWKVLSPNGGGEPSGELADKINGTFGSFDKFKEQF
ENAAKTRFGSGWAWLVVNNGELEVISTPNQDNPLMEGKTPVLGLDVWEHAYYLKYQNKRP
EYVSAFWNVVNWDEVTKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttgaattaccagaactaccttacgcgtacgatgctttagaaccaacaatt
gataaagaaacgatgaacattcatcatacaaagcatcacaatacttatgtaacaaaatta
aatggtgctttggaagggcattctgatctacaagataaatcattgaatgatttagttgca
agtttggattcagtaccacaagatatccgtacggctgtccgtaacaatggtggtggacat
gcgaatcatagtttattctggaaagttctttcacctaacggcggtggcgaaccatccggc
gaactagctgataaaattaacggtacttttggcagcttcgacaagtttaaagaacaattt
gaaaatgctgcaaaaacacgttttggatcaggttgggcttggttagtcgttaacaatggt
gaacttgaagtaatcagcactcctaaccaggataacccattgatggaaggtaagactcct
gttttaggtctagatgtttgggagcatgcttactaccttaaatatcaaaacaaacgtcct
gaatacgtttctgcattttggaatgtagttaactgggatgaagttacgaagaattataac
gaagctaagtaa

DBGET integrated database retrieval system