KEGG   Virgibacillus phasianinus: CFK37_14840Help
Entry
CFK37_14840       CDS       T04951                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vil01100  Metabolic pathways
vil01110  Biosynthesis of secondary metabolites
vil01130  Biosynthesis of antibiotics
vil01230  Biosynthesis of amino acids
Module
vil_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFK37_14840
Enzymes [BR:vil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     CFK37_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ASK63341
UniProt: A0A220U682
LinkDB All DBs
Position
3074336..3075418
Genome map
AA seq 360 aa AA seqDB search
MTCLNVQTSTNQYSIFIDENIRHETDKYLPKTYSSILIVTDEQVADLYLNDVKESLAGRS
NVFHTVIKNGEQSKDIDTFYQLQTKGIECGLDRRSLIIALGGGVIGDLAGFVAATFMRGI
DYVQLPTTILAHDSSVGGKVAINHKLGKNLIGNFYPPEAVIYDIQTLHSLVPKEIRSGYA
EIVKEALIADKELFADIMDAKLSNLTTTMLKEHIFRGVQIKKHFVQTDEKEKGIRAYLNF
GHTLGHALEAEYGYGSLAHGEAVAIGMLFAMEVSNDIYSINLPVDILVNWLRANNYPVHL
EKINTDRVLARMKSDKKTVNDQVQMVLLSDIGNPVSVKITDMDLQNYLKSFLIKMARDRK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtttaaatgtgcaaacaagtacaaatcagtattctatatttatagatgaaaat
attagacatgaaacagataaataccttcctaaaacttattcatcgattctcattgtaacg
gatgaacaagtggctgatttatacctgaatgatgtaaaagaaagtctcgcaggccgttct
aatgttttccatacagttataaaaaatggagaacaatcgaaggatattgatacattctat
cagctccagacaaagggaattgaatgtggactcgatcgcaggtcacttattattgccctg
ggcggcggagtgattggggatttagcgggttttgtcgccgcaacctttatgcggggaatt
gattatgttcagcttccaactactattcttgctcacgatagcagtgtcgggggtaaagtg
gccatcaaccataaactaggaaagaacctgattggcaacttttatccgccagaggcagtt
atttatgatattcaaacattacattcattggtgccaaaggaaattcgatcaggttatgct
gaaatagttaaggaagcattaattgctgacaaagaattgtttgccgacattatggacgca
aaacttagtaatctaacaactactatgttgaaggaacatatttttcgtggcgtccaaata
aaaaaacattttgtgcaaacagatgaaaaagaaaaaggcattcgtgcatacctgaacttc
ggccacacattgggccatgcgcttgaagccgaatatggctatggttccttagcacacgga
gaagctgtagcaatcggtatgctgtttgccatggaagtcagtaatgacatttattccata
aacctgccagtcgatatacttgtaaactggcttcgcgctaacaattatccagtacacctg
gaaaaaataaacacagatcgtgtgctcgcacgaatgaagtcagacaaaaagactgtaaat
gatcaagttcaaatggtattactttcggatattggaaatcctgtgtcagtaaagattaca
gatatggatctccagaactacctgaaatcctttttaattaaaatggcgagagataggaag
tga

DBGET integrated database retrieval system