KEGG   Virgibacillus phasianinus: CFK37_15965Help
Entry
CFK37_15965       CDS       T04951                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vil  Virgibacillus phasianinus
Brite
KEGG Orthology (KO) [BR:vil00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vil01001]
    CFK37_15965
Enzymes [BR:vil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFK37_15965
Protein kinases [BR:vil01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFK37_15965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like ETRAMP APH Kdo Haspin_kinase Seadorna_VP7 DUF4366 DUF5383 Connexin DUF2031
Motif
Other DBs
NCBI-ProteinID: ASK63544
UniProt: A0A220U5F9
LinkDB All DBs
Position
complement(3301026..3303122)
Genome map
AA seq 698 aa AA seqDB search
MLNGRLLNERYKIKNTIGGGGMANVYLARDIILERDVALKVLRLEYANDDEFIARFDREA
QSATSLSHPNIVNIFDVGEEDHILYMVMEYVDGMTLKEYIQKYGPINVDEALDIMKQISS
AIGHAHANNIVHRDIKPQNILIDSYGQVKVTDFGIAVALSATALTQTNSILGSVHYLSPE
QARGGMATKKSDIYSLGIVLFELLTARLPFSGQSPVSIALKHLQTDTPSVRRFNQDVPQS
VENIVLKATSKDPFNRYETVYDMEDALSTALDPDKLNEAKFVPPMGVGEETKAIPIITDN
QIHDNNQNTIVHQTNGATKSYAGDNNGEPTEKKKPKKKKKKDKKKNKKNGKKKKVLWITI
ILFILLASGVAALFIVPKLLQPGDVVIPDVKGMEYEKAVDKLQKLNLKTDREKAFSDDVE
KGYVISTDPSTDSEVKEESTVTLVVSEGKETVAFDDYVGRDYSQIKKLLEDKGFDVKAYE
KTSEATPGEIVSQIQPSPDSEVVPSETTVIFEISSGPELITLNNLQGMTQDEAVGYLEEQ
GLVANIIEEYSESTTEGEVTRQEPESGAELEEGETVNVYVSKGPEEKPPVSHTVTFTVPY
NPDLPPDEGNKGPDDSKKDKKDKKNKQENQDNPVEQNVKIYIKDVDHSISEVYKEETITE
DKEYTITLTIAPNQTAEYKVLRDGDIVINKTVPYEEGE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaatggtcgccttttaaatgagcgctacaagattaaaaatacaattggcggcgga
ggaatggccaatgtatatttagcaagagatatcattttagaacgtgatgtagcgctaaag
gtcctcaggctggaatatgcgaatgatgatgaatttatcgctcgttttgatcgggaagct
caatcagcgacaagcttatcccacccgaacattgttaacatttttgatgtgggtgaagag
gaccatatactgtatatggtcatggaatatgtggatgggatgacattaaaagaatatatt
caaaaatatggaccgattaatgtcgatgaagctttagacattatgaaacaaattagttcg
gcaattggtcatgcccatgcaaataatattgtacatagggacatcaaaccccaaaatatt
ttaatagattcgtacggacaggtaaaggtaactgattttggtatagcagttgctttaagt
gctaccgcattaacacaaacaaattcaatcctcggttctgttcattatttgtcgcccgaa
caggctcgtggtggaatggctaccaaaaaatcagatatttattcgcttggaattgtatta
ttcgaattgttgacagcccgactgcctttttccggacaatcgcctgtttctattgcattg
aaacatcttcaaacggatactccttctgttagaaggtttaatcaggatgttccgcaaagt
gttgaaaatattgtattaaaggccacgtccaaggatccttttaatcgttatgaaacggtg
tatgatatggaagatgcactatcaactgcgttagatccagataaattaaatgaagccaag
tttgttccgcccatgggggtgggggaggagacgaaggcaataccgattattaccgataat
cagatccatgataacaaccaaaacacgattgttcatcaaacgaatggtgcgaccaagtct
tatgcaggagacaataacggggaaccaactgaaaagaaaaagccgaaaaagaagaagaaa
aaagataaaaagaaaaataaaaagaatggtaaaaagaaaaaagtattatggattaccatt
attttgtttatattattagcttccggcgttgcagcattattcattgtgccaaagcttctg
caacctggtgacgtggtgattccagacgttaaagggatggaatacgaaaaggcagtagac
aaactacaaaaattaaatctgaaaacggaccgggaaaaggctttttcagatgatgtggaa
aagggctatgtaataagtaccgatccatcgaccgatagtgaggtaaaagaagagtcaaca
gttactctagttgtcagtgagggcaaagaaaccgtagcttttgatgattatgtgggtagg
gattacagtcagattaaaaagcttttagaggataaggggtttgatgtaaaggcatatgaa
aagacatccgaggcaacacctggggaaattgtatcacaaatccagccatcccccgattct
gaggtagtaccgagtgaaacaaccgtaatttttgaaatcagcagtgggcctgaactaatt
acattaaacaacctgcaaggcatgacacaggatgaggcagttgggtatcttgaggaacag
ggtcttgttgcgaacataattgaggagtattcggaaagtactacggaaggggaagtaaca
cgacaggaacccgaatcaggtgcagaacttgaagagggagaaacagtaaatgtttatgtt
tcaaaaggaccagaggaaaaaccgcctgtctcccacacagtgacatttactgtaccatac
aatcctgatttgccaccagatgagggtaacaaggggccggatgattctaaaaaggataag
aaagataaaaaaaataaacaagaaaatcaagataatcctgttgaacaaaatgtaaaaatt
tatataaaagatgtagatcattcgatttcagaggtttataaagaagaaacaatcactgaa
gataaggaatataccattacattaactattgcaccaaatcaaactgccgagtataaagta
ctgcgcgatggtgatatagtaataaataaaacagtcccgtatgaagaaggtgaataa

DBGET integrated database retrieval system