KEGG   Vulgatibacter incomptus: AKJ08_0688Help
Entry
AKJ08_0688        CDS       T04035                                 

Definition
(GenBank) Two-component sensor PilS
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
vin  Vulgatibacter incomptus
Pathway
vin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vin00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKJ08_0688
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vin01001]
    AKJ08_0688
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vin02022]
    AKJ08_0688
   02035 Bacterial motility proteins [BR:vin02035]
    AKJ08_0688
Enzymes [BR:vin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AKJ08_0688
Protein kinases [BR:vin01001]
 Histidine kinases
  NtrC family
   AKJ08_0688
Two-component system [BR:vin02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   AKJ08_0688
Bacterial motility proteins [BR:vin02035]
 Pilus system
  Twitching motility proteins
   AKJ08_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_4 PAS PAS_9 PAS_8 HATPase_c_2 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AKU90301
UniProt: A0A0K1PA63
LinkDB All DBs
Position
836317..837975
Genome map
AA seq 552 aa AA seqDB search
MSASPEGATLRGGDEELRKRLLWITAIRIAAVTVLVGTTATLVFKGNEPLGGTPAVSLSV
LAAATNLLQIVVAILLRRGRALRFLAALQVVGDVAFAAALVYLTGGSDSLFTFLFLIAIV
TGGILLSRPGAWGAAALSFAADVAVVVGLQRGFIPPIDKALQPSRLAWDALAQTLFTHGS
AFALTAMLAAYAAAQISTAGRRAAVAESSLQRLHALHDAIVRSISSGIATADDRGRITYL
NRAGEEILGQSAAALLGMEMTRVFPTLTGAVEGEGGKAARLESVWTTSTGDMRQLGFTVT
PLVDDGGRRIGSTAVFQDLSPYRELQRRAARSERLAAVGQLAAGLAHELRNPLASMSGSV
ELLAAQLEDPAAQRLFGIVLRESDRLNRLVTDFLGFAGTAPTNLGAVELASVAGEVLTLV
GADPAAAGFARTAELEPASALADEGQVRQVVWNLVRNAVEASSSDGEIRVTTGTRKGQAF
VRVEDRGAGIHPELLERIFDPFFTTKDRGTGLGLATVHRIVDGLGGHLEVDSVVGEGTRF
TVVLPAFPQQVG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgtcgcccgaaggtgccaccctccgcggcggcgacgaggagctgcgcaagagg
ctcctctggatcaccgcgatccgcatcgccgcggtgacggtgctggtgggcaccaccgcc
accctggtcttcaagggcaacgagccgctcggtggaacaccggcggtctccctctccgtc
ctcgcggcggcgaccaacctgctgcagattgtcgtcgcgatcctgctgcgccggggccgc
gccctgcgcttcctcgcggcgctccaggtggtgggagacgtcgccttcgcggcggccctc
gtctatctcactggcggctccgactcgctcttcaccttcctcttcctcatcgccatcgtg
accggcggcatcctcctctcgcgccccggcgcgtggggagcggcggcgctctccttcgcc
gccgacgtcgccgtcgtggtcggcctgcagcgcggcttcattcctcccattgacaaggcc
ctccagccttcgcgcctcgcgtgggatgcgctcgcccagaccctcttcacccatggcagc
gccttcgccctgaccgcgatgctggccgcctacgctgccgcccagatcagcaccgccggg
cgtcgggccgccgtcgccgagtcgagcctccaacgcctccacgccctccacgacgccatc
gtgcgctccatcagcagcgggatcgccacggccgacgatcgagggcgcatcacctatctc
aaccgtgccggggaggagatcctcggccagagcgctgctgcgctcctcggaatggagatg
acgcgggtcttccccaccttgaccggggccgtcgagggggagggcggaaaggcggcgcgc
ctcgagagcgtctggactacgagcacgggagacatgcgccagctcggcttcaccgtcacg
cccctcgtggacgacggcggaaggcgcatcggctccaccgctgtgtttcaggatctcagt
ccgtaccgcgagctacagcggagggccgcgcgctccgagcgccttgccgcggtggggcag
ctcgccgccggcctcgcccatgagctgcgaaatccgctggcctccatgtccggctccgtc
gagctcctcgccgctcagctcgaagatcccgcggcgcagcgcctcttcggcatcgtgctc
cgcgagtccgaccgcctgaaccgcctcgtcaccgacttcctcggtttcgccggcaccgcg
cccaccaatcttggggccgtggagctggcgtctgtcgccggcgaggtcctcacgctcgtc
ggcgccgatcctgctgccgcgggcttcgccaggacggccgagctcgagcccgccagcgcg
ctcgccgacgagggccaggtccgccaggtggtctggaacctcgtgcgtaacgccgtcgag
gcctcgagctcggacggcgagatccgcgtcaccaccggtacgcggaagggccaggccttc
gtccgggtcgaggatcgtggcgccgggatccatcctgagctcctcgaacggatcttcgac
ccgttcttcaccaccaaggatcgcggcacgggcctcgggctggcgaccgtccaccgcatc
gtagacggtctcgggggccacctcgaggtcgacagtgtggtaggggagggtacccgtttc
actgtcgtgctccccgcgttcccccagcaggtcggatag

DBGET integrated database retrieval system