KEGG   Vulgatibacter incomptus: AKJ08_0790Help
Entry
AKJ08_0790        CDS       T04035                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vin  Vulgatibacter incomptus
Brite
KEGG Orthology (KO) [BR:vin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vin01001]
    AKJ08_0790
Enzymes [BR:vin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AKJ08_0790
Protein kinases [BR:vin01001]
 Serine/threonine kinases: Other
  Bacterial family
   AKJ08_0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo TPR_14 TPR_16 ABC1 Pkinase_fungal FTA2 TPR_2 Kinase-like Seadorna_VP7 TPR_21
Motif
Other DBs
NCBI-ProteinID: AKU90403
UniProt: A0A0K1PA39
LinkDB All DBs
Position
complement(944753..946762)
Genome map
AA seq 669 aa AA seqDB search
MIGRQLDRYRLLEEIGSGGMAVVYKAHDAALERDVAVKVMHPHLAGREESRRRFSREARA
VARLRHPNIVEIFDFSGDDAAESFIVTEYVKGRTLLAFAQEIGIGLPEVGALLAERLAEA
LEHAHAAGVIHRDLKPENVMVGDDGELKLMDFGIARMIGKDERMTMTGALVGSPLHMAPE
VIEGGEIGVAADLFSLGTILYWMVTGRMAFEGNNTTQTLRRILEADYPDPRLAAPACSDE
LAEVIATCLRREPDTRYASMGALRAALLEVLAASGLSAGDAELRAFFGDPQGFREALRLR
LLAKLLAEGHAAMAARRPARAVAVLDRVLALDPGNERAKALLERMGRGRMLRRRLAKGAI
VLGSAVLVAGGGFGLWSWMNRPEAPSGVAPPSEDPPRDRPSESPGSLPRERTSAEADPTA
PRPEASAGPTSPATPDRPASDRPVSDRPVSDRGARAEPGEGAPAGLDREAKASPETAPGR
NRDSARAAAPEANERPTRSKRMVQLRWVPQGATLSIDGAAVDTVAPSWSGELSAGHHTLS
LTHSGCCEAWEETLEIAEGAEPVQRSIVLAPLESGWFTIDSDLPDAEVWLDGTYKGTVAD
VNRRGGVAVAFSRNDAGQERYVKSIRFELFPPSGSGIAGSLRGEATVRAGEHARSAPLRF
ALPPAGGDR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggcgccagctcgatcgataccggctcctcgaggagatcggaagcggcggcatg
gccgtggtctacaaggcccacgacgccgccctcgagcgcgacgtcgcggtcaaggtgatg
cacccgcacctcgccggccgcgaggagagccggcgccggttctctcgtgaagcgcgggcc
gttgcgcggctgcgccacccgaacatcgtcgagatcttcgacttctccggcgacgacgcg
gcggagagcttcatcgtcacggagtacgtgaagggacgcaccctcctcgccttcgcccag
gagatcggcatcgggctccccgaggtcggcgccctgctggccgagaggctggccgaggcc
ctcgagcacgcccacgccgccggcgtgatccatcgcgatctcaagcccgaaaacgtgatg
gtcggcgacgacggcgagctgaagctgatggacttcggcatcgcccggatgatcggcaag
gacgagcggatgaccatgacgggcgcgctcgtcggctcgccgctccacatggctccggag
gtcatcgagggcggcgagatcggggtcgcggccgacctcttctccctggggacgatcctc
tactggatggtcaccggccggatggccttcgaggggaacaacaccacccagaccctgcgg
cggatcctcgaggccgactatcccgatccccgcctcgccgctcccgcctgctcggacgag
ctcgccgaggtgatcgccacgtgcctccggcgcgagccggacacgcgctacgcgagcatg
ggggcgcttcgggccgcgctcctcgaggtcctggcggcgagcggcctctccgccggagac
gcggagctccgggccttcttcggggatccgcagggtttccgcgaggcgctccgtctccgg
ctgctggcgaagctcctcgccgagggccacgcggcgatggcggcgaggcgccctgcccgc
gcggtggccgtcctcgatcgcgtgctcgccctcgatcccggaaacgagcgagcgaaggcg
cttctcgagcggatgggacggggccggatgctccggcggcggctcgcgaaaggcgccatc
gtgctgggctccgcggtcctggtcgccgggggcggattcgggctctggagttggatgaac
cgccccgaggctccgtcgggcgttgctccaccgtccgaggaccctccgcgggaccgcccg
agcgaatcgcccggcagcctcccccgagaacgcacgagcgcggaagccgacccgacggcg
ccgcgcccggaggcctcagcggggccgacgtcgcctgccacgcccgatcgacccgcgtcc
gaccgacccgtgtccgatcgccccgtgtcggaccggggcgctcgagccgagccaggggaa
ggggccccggcaggcctcgaccgcgaggcgaaggcctcccccgagacggcacccggacgc
aaccgggattcagcccgggccgcagcgccggaagccaacgagcggccgactcggtccaag
cgaatggtccagcttcggtgggtgccgcagggcgcgaccctctccatcgacggcgccgcc
gtcgacacggtggctccctcctggtccggtgagctctccgccggccaccacaccctctcc
ctcacccactccggctgctgcgaagcctgggaggagaccctcgagatcgccgaaggagcc
gagccggtccagcggagcatcgtcctcgcgcccctcgagagcggctggttcacgatcgat
tccgacctccccgacgctgaggtctggctcgacgggacctacaagggtacggttgccgac
gtgaatcggcgaggaggggtcgcggtggccttctcccggaacgacgccgggcaggagcgc
tacgtgaagtccatccgcttcgagctcttcccgccgagcggctcggggatcgccggctcc
cttcgcggcgaggccaccgtgcgggccggcgagcacgcccgctccgcgccgctgcgcttc
gcgctgcctcctgcgggaggcgatcgttga

DBGET integrated database retrieval system