KEGG   Vulgatibacter incomptus: AKJ08_1898Help
Entry
AKJ08_1898        CDS       T04035                                 

Definition
(GenBank) Glutathione S-transferase family protein
Organism
vin  Vulgatibacter incomptus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKU91511
UniProt: A0A0K1PDM3
LinkDB All DBs
Position
2260367..2261134
Genome map
AA seq 255 aa AA seqDB search
MSNVELYSMSFCPFAQRARLMLRRKGVDFATHEIDVTKPRSASFLQINPEGKVPVIRHEG
RVLNESSVICEYLEDAFPEPPTLPREPYTRALARIMVDHCNNQFVPLMYRLLMNQDRSAD
AKLIDQALATWRWVDELLSRHNPNGTFLDDRDGFSLAEINYAPFFQRYCLNEHYRGFRLP
DEAGFARVRRFRDALLGDALVKETGMSDEDFIKLYFDYSLGFGNGSVPPGRERSSFDLSV
PLAERPLPPAAPRAV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgtggagctctacagcatgtccttctgccccttcgcgcagcgcgcccggctc
atgctgcgccgcaagggcgtggatttcgcgacccacgagatcgacgtcaccaagccgagg
agcgcgtcgttcctccagatcaatccggagggcaaggtccccgtgatccgccacgagggc
cgcgtgctgaacgagtcgagcgtgatttgcgagtacctcgaagacgccttccccgagccg
cccaccctcccccgcgagccctacacgcgggccttggcgcggatcatggtcgaccactgc
aacaaccagttcgtgccgctcatgtaccggctgctcatgaaccaggaccgctccgccgac
gcgaagctcatcgaccaggcgctcgccacctggaggtgggtggacgagctcctcagccgc
cacaacccgaacggcaccttcctcgacgaccgggacggcttctccctggcggagatcaac
tacgcgccgttcttccagcggtattgcctgaacgagcactaccggggattccggctcccc
gacgaggccggcttcgcccgcgtgcgccgcttccgggacgcgctcctcggagacgccctc
gtcaaggagacgggcatgtcggacgaggacttcatcaagctctacttcgactactcgctg
ggcttcggaaacgggagcgtcccgccgggccgcgagcgcagctccttcgacctctccgtt
cccctcgcggagcgaccgctcccgcccgccgctcccagggccgtctga

DBGET integrated database retrieval system