KEGG   Vulgatibacter incomptus: AKJ08_2249Help
Entry
AKJ08_2249        CDS       T04035                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
vin  Vulgatibacter incomptus
Pathway
vin00471  D-Glutamine and D-glutamate metabolism
vin00550  Peptidoglycan biosynthesis
vin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AKJ08_2249
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AKJ08_2249
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vin01011]
    AKJ08_2249
Enzymes [BR:vin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AKJ08_2249
Peptidoglycan biosynthesis and degradation proteins [BR:vin01011]
 Precursor biosynthesis
  Amino acid ligase
   AKJ08_2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C CbiA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKU91862
UniProt: A0A0K1PED7
LinkDB All DBs
Position
complement(2645803..2647176)
Genome map
AA seq 457 aa AA seqDB search
MFRGRRPTIHFVGIGGIGMSGIAEVLVNLGYPVTGSDLKEGDTTRRLEGLGARIAVGHRA
ENVGKADVVVISSAVRQQNPEVVEARRRAIPVIPRAEMLAELMRLKVGIAVAGSHGKTTT
TSMIAHLLAAGGLDPTAVVGGKLNNLGSNAKLGNGEYMVVEADESDGSFLRFSPAIAVVT
NVDPEHLDHYGDFDTLQRAFVDFVNKVPFYGVAVMCADHPVVQAMLPSVDRRCVTYGLSP
QADYRAEAIETNAFEVKFVATRGGEPLGAFRLPMIGLHNVQNALAAIAVADDVGLPMDKV
RDAFETFSGVQRRFTIRGEAAGVTVVDDYGHHPAEIKATLDGARRAFPKRRIVVAFQPHR
YSRTRDLLADFATSFNEADRLLVTEIYAASEDPIPGVTGEAFAGAVRSHGHRDVDFAKRS
GLASTLRGAVREGDLVITLGAGDISQVSTELLELLGQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcgaggcagaaggccgaccatccacttcgtaggcatcggcgggatcgggatgagc
ggcatcgccgaggtgctcgtgaacctcggctatcccgtcacgggctccgacctcaaggag
ggcgacaccacccgccgcctcgagggcctcggcgcgcggatcgcagtcggtcaccgggcc
gagaacgtgggcaaggccgacgtggtcgtgatctcctcggccgttcgccagcagaacccc
gaggtggtagaggcgcgccgccgggccatccccgtgattccccgggcggagatgctcgcg
gagctcatgcgcctcaaggtcggcatcgccgtcgcgggctcccacggcaagaccaccacc
acctcgatgatcgcccacctcctcgccgcgggcggcctcgaccccaccgccgtggtgggc
ggcaagctcaacaacctcggctccaacgccaagctcggcaacggcgagtacatggtggtg
gaggccgacgagtccgacggcagcttcctgcgcttctcgccggcgatcgccgtcgtcacc
aacgtcgaccctgagcacctcgaccactacggcgacttcgacacgctccagcgcgccttc
gtcgacttcgtcaacaaggtgcccttctacggcgtggccgtgatgtgcgccgaccacccg
gtggtgcaggcgatgctccccagcgtcgaccgccgctgcgtcacctacgggctctcgccc
caggccgactaccgggccgaggccatcgagacgaacgccttcgaggtgaagttcgtggcc
acgaggggaggcgagccgctgggcgccttccgcctccccatgatcggcctccacaacgtg
cagaacgccctggccgccatcgccgtcgccgacgacgtgggcctgcccatggacaaggtg
cgcgacgccttcgagaccttctcgggtgtgcagaggcgtttcaccatccgtggagaggcg
gctggtgtcaccgtcgtcgacgactacgggcaccatccggccgagatcaaggccaccctc
gacggcgccaggcgggccttccccaagcggcggatcgtcgtcgccttccagccccaccgc
tactcgcggacgcgggacctcctcgccgacttcgccacctccttcaacgaggccgaccgc
ctgctcgtcaccgagatctacgccgccagcgaggatccgatcccgggcgtcaccggcgag
gccttcgccggcgccgtccgctcccacggccaccgcgacgtggacttcgcgaagcggtcc
gggctcgcctccacgctgcgcggggccgtccgcgagggcgacctggtgatcactcttggc
gccggcgacatcagccaggtgagcaccgagctcctggagctcctggggcagtga

DBGET integrated database retrieval system