KEGG   Vulgatibacter incomptus: AKJ08_3704Help
Entry
AKJ08_3704        CDS       T04035                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
vin  Vulgatibacter incomptus
Pathway
vin00970  Aminoacyl-tRNA biosynthesis
vin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AKJ08_3704
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vin03029]
    AKJ08_3704
Enzymes [BR:vin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AKJ08_3704
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AKJ08_3704
Mitochondrial biogenesis [BR:vin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AKJ08_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKU93317
UniProt: A0A0K1PII1
LinkDB All DBs
Position
4331845..4333314
Genome map
AA seq 489 aa AA seqDB search
MKPTDLTLAGLAASLGRKELSSLEATQACLERIEATDPKIGAFLHVDAEGALAQARASDE
RRAMGASLGPLDGVPVALKDIFCTKGIPTTCGSKILEGFVPPFDSSHVIRLAQAGAVMVG
KLNMDEFAMGSSNETSAYGPCRNPWDLERTPGGSSGGSAAAVAARQVFGTLGTDTGGSIR
QPAAFSGVTGIKPTYGRCSRYGVIAFASSLDQVGPFGRTAEDCALLLQAIAGRDPMDSTS
LDVPVPDWASGLSSASVKGMRLGVPKEYFVEGVDPEVEAAVRAAMKRLEELGAELVPVEL
PHTEYGISTYYVVAPAECSSNLARFDGVRYGLSERQEGGLREMYFRTRAGGFGPEVKRRI
MIGTWALSSGYYDAYYLRAQKVRTLIKRDFEEAFRKVDAIVTPTTPTAAFRLGERADDPL
QMYLADVFTLACNLAGLPGMSLPCGFTSGGLPIGMQLLGKPLDEATLFRVGAAYQAVTDW
HERAPQEVA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcctaccgatctcacccttgccggcctcgcggcgagcctcgggcgcaaggagctc
tcgtcgctcgaggcgacccaggcctgcctcgagcgaatcgaagccaccgatccgaagatc
ggcgccttcctccacgtggatgcggagggcgccctcgcgcaggcgcgagcgtccgacgag
cgccgggccatgggcgccagcctcggcccgctggacggcgttccggtcgccctcaaggac
atcttctgcaccaaggggattccgacgacctgcggctcgaagatcctcgagggcttcgtg
ccgcccttcgactcctcccacgtgatccgcctcgcccaggcgggcgcggtgatggtgggc
aagctgaacatggacgagttcgccatgggctcgtccaacgagacctcggcgtacgggccg
tgccggaacccctgggatctcgagaggacgccgggcggctcctccggcggctccgcggcg
gcggttgcggcgcggcaggtcttcgggaccctgggaaccgacacgggcggctcgatccgg
cagccggcggccttctccggcgtcacggggatcaagccgacctacggccgctgctcgcgc
tacggcgtgatcgccttcgcgtcctccctcgaccaggtggggcccttcggccgcacggcc
gaggactgcgcgctcctgctccaggccatcgcgggccgtgatccgatggactcgacgtcc
ctcgacgtgccggtgcccgactgggcctccggcctctcgagcgccagcgtgaaggggatg
cgtctcggcgtgccgaaggagtacttcgtcgaaggggtcgaccccgaggtggaggcggcg
gtgcgggcggcgatgaagcgcctggaggagctcggcgccgagctcgttccggtcgagctc
cctcacaccgagtacggcatctccacctactacgtggtggcgcccgccgagtgctcctcc
aacctcgcccgcttcgacggcgtgaggtacggcctctcggagcggcaggagggcggcctg
cgggagatgtacttccgcacccgcgccggcggcttcgggcccgaggtgaagcgccggatc
atgatcggcacctgggccctctcgtcgggctattacgatgcgtactaccttcgcgcacag
aaggtccgcacgctcatcaagcgcgacttcgaggaggccttccgcaaggtggacgcgatc
gtcacgcccaccacgcccaccgcggccttccgcctcggggagcgcgccgacgatccgctc
cagatgtacctggcggacgtcttcaccctggcgtgcaacctggcgggcctccccggcatg
agcctcccctgcggcttcacgtcgggcggcctgccgatcgggatgcagctcctgggcaag
cctctcgacgaggcgacgctcttccgggtgggcgcggcctaccaggccgtcaccgactgg
cacgaacgggcaccgcaggaggtggcctag

DBGET integrated database retrieval system