KEGG   Virgibacillus sp. SK37: X953_03005Help
Entry
X953_03005        CDS       T03219                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00473  D-Alanine metabolism
vir01100  Metabolic pathways
vir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X953_03005
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    X953_03005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vir01011]
    X953_03005
Enzymes [BR:vir01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     X953_03005
Peptidoglycan biosynthesis and degradation proteins [BR:vir01011]
 Precursor biosynthesis
  Racemase
   X953_03005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIF42384
UniProt: A0A075JKA6
LinkDB All DBs
Position
546327..547451
Genome map
AA seq 374 aa AA seqDB search
MSGTIYRHTWVEVDLEAIEYNIQQIKKRISNKTKIIAVVKADGYGHGSVQVAKKAIEAGA
SALAVALFEEALTLREAEITVPILVLGWVPAKVAPVAAVNNITLTFFQKEWLQEVSTYQL
EDKLQVHMKWDTGMGRIGVRTKSELKELLYALNENPSIYLTGVFTHFATADEADMSYFYE
QKSRFEEMLKTFTEVWGKPVDVHIGNSASAIRLPEEMYDYIRFGISMYGLYPSGTVKAER
DIELKQAFSLHSRLAHVKKIAAGETVSYGATYKAEKDEWIGTIPIGYGDGWIRKLQGVDV
LIEGKRMPIVGRICMDQTMIRLDGEYPIDTKVTLIGKQNSAEIDMDEIAAHAETINYEIP
CIINRRVPRLYMNE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaccatatatagacacacctgggtcgaagtggacctagaagcgatcgaatac
aatattcaacaaattaaaaaacgtatttccaataaaactaaaattattgcagtagttaaa
gctgatggttatggacatgggagtgtgcaggttgcgaaaaaggcaattgaagctggggct
agtgcgttggctgttgccctgtttgaagaggcattgacgcttagggaggcggaaattaca
gttcctattttagtgctgggctgggtgcctgcaaaagtggcccctgttgcggctgtaaac
aatattacgttaacttttttccaaaaggaatggctgcaggaagtaagtacttatcaatta
gaggataagttacaagtgcatatgaaatgggatacaggaatggggagaattggagtaagg
acaaaatctgagctgaaagaacttctttatgcattaaatgaaaatcccagcatatattta
acaggagtgttcacacattttgcgactgcagatgaagcagatatgtcctatttctatgaa
caaaagagtcgatttgaagagatgctgaaaacattcacggaagtatggggaaaaccggtt
gacgttcatattggtaatagtgctagtgcaattcgtttacctgaagaaatgtatgattat
attcgttttgggatttctatgtatggattatacccatctggtacggtaaaagctgaaaga
gacatagaattaaagcaagcattttcattgcacagcagattggcccacgtcaagaagata
gctgcaggagaaacagttagctatggtgcaacctataaagcggaaaaagacgagtggatt
ggaacaattccaattggctatggagacggatggataaggaaactacaaggggtagatgta
ctaattgaagggaaaagaatgcctattgtaggaagaatttgtatggatcagaccatgatt
cgacttgatggagaatatcccattgacacaaaggttacactgataggtaagcaaaatagt
gcagaaattgacatggacgaaatcgctgcccatgcagaaacaattaactatgagatccct
tgtattatcaatcgacgggttccacgcttgtatatgaatgaatag

DBGET integrated database retrieval system