KEGG   Virgibacillus sp. SK37: X953_03630Help
Entry
X953_03630        CDS       T03219                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00970  Aminoacyl-tRNA biosynthesis
vir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vir00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    X953_03630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vir03029]
    X953_03630
Enzymes [BR:vir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     X953_03630
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     X953_03630
Mitochondrial biogenesis [BR:vir03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    X953_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AIF42468
UniProt: A0A075JQP8
LinkDB All DBs
Position
668479..668769
Genome map
AA seq 96 aa AA seqDB search
MADITKEQVKHVANLARLAITEEEAEMFQGQLNSIISFAEQLNELDTEGVEPTTHVLDLK
NVLRKDEPKEWITQEEALKNAPDKKDGHYRVPSILE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatcaccaaagaacaggttaaacatgttgcgaatttggcaagacttgcaatt
acagaagaagaagcagaaatgtttcagggacagttgaattccattatttcctttgcggag
caattaaatgaattggatacagaaggtgtagaaccaactacacacgtattagatttaaag
aacgtattacgcaaggacgagccgaaggaatggattacacaagaggaagcactgaaaaat
gctcctgataaaaaagatggacattatcgcgtgccatccattttggaatag

DBGET integrated database retrieval system