KEGG   Virgibacillus sp. SK37: X953_09820Help
Entry
X953_09820        CDS       T03219                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vir  Virgibacillus sp. SK37
Brite
Enzymes [BR:vir01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     X953_09820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIF43415
UniProt: A0A075JNY4
LinkDB All DBs
Position
1800031..1800642
Genome map
AA seq 203 aa AA seqDB search
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHEDLKNKSLNDLIS
NLDAVPENIRTAVRNNGGGHANHSLFWKLMSPNGGGKPTGEVADKINDKYGSFEKFQEEF
AAAAAGRFGSGWAWLVVNNGEIEIMSTPNQDNPLMEGKKPILGLDVWEHAYYLKYQNKRP
DYISAFWNVVNWDEVEKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattaccagaactaccatacgcgtatgatgcgctagaacctactatt
gataaagaaacgatgaatattcaccatacgaagcaccataatacttatgtgactaagcta
aacggtgctttggaaggtcatgaggatcttaaaaacaaatctctaaacgaccttatcagc
aatttagatgccgtgccggagaatattcgcacagcagttcgtaataacggtggcggtcat
gcaaaccacagtcttttctggaagctaatgtctccaaatggtggcggcaagccaacaggt
gaagttgcagataagattaatgataagtatggcagctttgagaaattccaagaagaattt
gcagcagcagctgctggccgttttggatctggctgggcatggttagtagtaaataacgga
gaaattgaaatcatgagtactccaaatcaagataacccgttaatggaaggaaagaaacca
attttgggacttgatgtttgggagcatgcttactatttaaaatatcaaaataagcgtcct
gattatatttcagctttctggaatgtagtcaactgggatgaagtagaaaagaattacaac
gaagctaaataa

DBGET integrated database retrieval system