KEGG   Virgibacillus sp. SK37: X953_10880Help
Entry
X953_10880        CDS       T03219                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vir01100  Metabolic pathways
vir01110  Biosynthesis of secondary metabolites
vir01130  Biosynthesis of antibiotics
vir01230  Biosynthesis of amino acids
Module
vir_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    X953_10880
Enzymes [BR:vir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     X953_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AIF43569
UniProt: A0A075JNV4
LinkDB All DBs
Position
1981990..1983159
Genome map
AA seq 389 aa AA seqDB search
MRYLTAGESHGKKLTTIIEGIPARMPLVKENINESLLRRQKGHGRGKRMQIEKDLVEITS
GIRHGYTLGSPISLVINNDDFKHWVDIMGEDPMEADAKIRRVITRPRPGHADLNGAMKYG
HRDIRNVLERSSARETAARVAAGAVAKTLLKQLGIEISGYVKEIAGIEAKEVEELSINDR
QEISEDSPVRVLDKDVEQEMMDAIDQAKKEGDSIGGVVEVYVEGMPAGVGSYVHYDRKLD
SRIAGSVVSINAFKGVEFGLGFEAAKRNGSNVHDEIAWDEETGYYRKTNRLGGFEGGMTT
GMPIVVKGVMKPIPTLMKRPLQSVDIETKEPFKATVERSDACAVPAAAVVMEHVVAFELA
KAITEQFPSDQFSTLKKAIDDYREEIRCF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttatttaacagcaggggaatcccacggaaaaaaactaactacaataattgaaggt
ataccagctcgcatgcctctagttaaagagaacatcaatgaatcattattgcgtcgtcaa
aaagggcatgggcgcgggaaacggatgcagatcgaaaaagatcttgtagagataaccagt
ggtattagacatggctacactttaggctcaccaatctctttagtaataaacaatgatgac
tttaagcattgggtggatattatgggagaagaccctatggaggctgatgcaaaaatcaga
cgtgttataaccagaccgagaccaggtcatgctgatttaaatggtgctatgaaatatgga
caccgagacattcgcaatgtattagaacgatcttctgccagagaaacagcagcacgagtt
gcagcaggtgctgtggccaaaacattattaaagcaattaggtatcgaaatctctggttac
gtaaaagagattgccggaattgaagcgaaggaagtagaagaacttagcatcaatgacaga
caggaaatttccgaagactcaccagtaagagttttggataaggatgtagaacaggaaatg
atggacgcgattgatcaagctaagaaagaaggcgactcaattggcggagttgttgaagtt
tatgtagaaggtatgcctgcgggagtgggatcatatgtccattacgatagaaaattagat
agccgtattgctggaagtgtcgtgagtataaatgcttttaaaggagtagaattcggtctt
ggttttgaagctgccaaaagaaatggaagcaatgtacatgatgaaattgcttgggacgaa
gaaacaggctattatcgtaaaacaaatcgtctcgggggttttgagggtggtatgacaact
gggatgccaattgttgtaaagggagtaatgaaacctattcctacgttaatgaagagaccg
ttgcaaagcgtcgatattgaaactaaagagccatttaaagctacggtagagagatcagat
gcatgtgctgtccccgctgctgctgttgtcatggagcatgtcgtagcatttgaattagct
aaagctataacagaacagtttccgagtgaccaattctctacattaaagaaagcaattgac
gattatcgtgaagaaatcaggtgtttttaa

DBGET integrated database retrieval system