KEGG   Virgibacillus sp. SK37: X953_15560Help
Entry
X953_15560        CDS       T03219                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    X953_15560
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    X953_15560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:vir02042]
    X953_15560
Enzymes [BR:vir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     X953_15560
Bacterial toxins [BR:vir02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   X953_15560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 BNR_3 Laminin_G_3 BNR DUF4185 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AIF44402
UniProt: A0A075JSD0
LinkDB All DBs
Position
complement(2941778..2944198)
Genome map
AA seq 806 aa AA seqDB search
MKKNVYVIIFSVLILVFIGADQKLVEASAPNAEPIVSVENEQIENGYFTNLNSEIDKLKK
LEEGTIVVRFRYTGSSIMSLFSLSNSNLANGHFHLYISPSSIGSENRFQKPGEPQENVHT
SAAANLKEGHVYTLAMVVDKEAGYKYFLDGELIKEDTTSPRKFLNNIHKPNSAQLGRTER
AAGGNNYPFKGDIDFAKIYNQPLSDETLTAITGVTSAAPLVNPMPDEAYVTDPESIFYPG
FMDSNNYRIPALFYTEKGTLIAGIDRRVENGADSPNNIDAVIRRSFDDGDTWEKNGIMVN
DYPDQASNIDLAFLQDKTNERVFALVDGFPHGAGLMGGFGVNSYKGTGFKSIDGEKYMLL
TDESGKEYTVRDGGQVYDNKGNQTNYKVDERRNLYLNGEKIDNIFSKTTPLKPYKTSYLE
LYYSDDEGETWEGTIDLNDEVKEEWMAFLGTGPGNGIQLTEGEHKGRLVFPVYFLNDNFK
QASAVVYSDDNGKTWHRGASPNEGRVVGNGEVIHEKDFNNNAYEVTESQVVEMPDGQLKL
FMRNRSGYAQIATSFDGGETWDDEVVTEKDLVAPYSQMSVIRYDGNVDGKEALIFSSANN
SVSRVNGTVRIGLIEESGTYENGHKKYSIDWKYDQLVKEGHYGYSSLTNLTDGNIGLFYE
GTPNTVMDFRKFNTDFVKWKKEKEAPAPRVEAFGTVKKTPNVYRPGETIQVEMTFDSYVM
LTGDRKLSGTIGDSEIEFKLAEQVSATTFLFEGTIPEIRPRKRELDLAFSNNIDVYNVYG
KVLDKKEENSKLTDDVRIRANGKGKR
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaatgtatacgttatcattttttcggtgttaattcttgttttcataggagca
gatcagaagctagttgaagcatctgcacctaatgctgaaccaatagtaagtgtagagaat
gagcaaatagaaaatgggtatttcacaaatcttaatagtgaaattgataagctgaagaaa
ttggaagaagggacgattgttgtacgctttcgttatacgggatcttctattatgtcatta
ttttcactaagtaatagtaatctcgctaatggtcatttccatttatacatctccccatcg
tccattggtagtgaaaatcgatttcaaaagccaggggaaccccaagaaaacgttcataca
tctgctgctgcaaacctaaaagaaggacatgtctatacactggcaatggtggtagataaa
gaagcaggatataaatacttcctggatggagaattaattaaagaagacaccacgtcacct
aggaaatttttaaacaatatacacaagccgaacagtgctcaacttggcagaacagagaga
gcagctggtgggaacaattatcctttcaagggggatattgactttgcaaagatttacaat
cagccactctctgacgaaactttgacggcaattacaggagtgacaagtgctgcaccactt
gtaaatccaatgccagacgaagcctatgtaacggaccctgaaagtattttttacccaggc
tttatggactccaataattatcgaattccagcactattttatacagaaaaaggtacattg
attgccggaattgaccgccgggtagaaaatggagctgattctccaaataatattgatgcg
gttattcggagaagctttgatgatggagacacttgggaaaagaacggtattatggtcaac
gactatcctgaccaagcttctaatattgatttagcttttcttcaggacaagacaaatgaa
cgcgtattcgccttagtagatggctttccgcatggtgcaggtctaatgggtggttttgga
gtgaattcctataaaggaactggttttaaatcaattgatggggaaaagtatatgcttcta
acagatgaatccggaaaggaatatactgttcgcgatggtggacaagtgtatgataataaa
ggaaatcaaacgaattacaaggttgatgaaagaaggaacctatacttaaatggagaaaaa
atagacaatatattcagtaagacgacacctttgaagccatataaaacttcctatctcgaa
ctctattatagtgatgatgaaggggaaacatgggaaggaacgattgacttaaatgatgag
gtaaaagaagagtggatggcattcctaggtactggaccaggtaacggtattcaattaaca
gaaggtgaacataaaggaagacttgttttcccagtgtactttttaaatgataactttaaa
caggcgagtgccgttgtttatagtgacgataatggtaagacatggcaccgcggtgcatca
cctaatgaaggaagagttgtaggaaacggagaggtcattcatgagaaggactttaataat
aatgcctacgaggttactgagtcacaggttgttgaaatgcctgatggtcagctgaaattg
tttatgagaaaccgttctggttatgcgcaaattgctacaagctttgacggtggagaaaca
tgggatgacgaagttgtaacagaaaaggatctggttgcgccatatagccagatgtctgtt
attcgctatgatggtaatgttgatggcaaagaggcacttatcttctccagtgccaataac
tctgtgagcagagtgaatggaacagtacgaatagggctaatagaagaatcaggaacctat
gaaaatgggcataaaaaatattcaattgattggaaatatgatcagcttgtcaaagaaggg
cattacggctattccagtcttactaatttaacagatggaaatattggtcttttttatgaa
ggtaccccaaatactgtcatggattttaggaaatttaataccgactttgttaagtggaaa
aaggagaaagaggctcccgcaccacgagttgaagcttttggtacagtaaagaaaacccca
aatgtttatcggcctggagaaactattcaggtggaaatgacatttgatagctatgtcatg
ttaacgggtgatcggaagctctctggaacgatcggtgactcggaaattgaatttaagtta
gcagagcaagtttctgccactacatttttgtttgaagggacaatccctgaaattcgtcca
agaaaacgagagttagatcttgcgtttagcaataacatagatgtatacaatgtttatgga
aaagttttagataagaaggaagaaaattcaaaactgacagatgacgtgcgcatccgagct
aacggcaaagggaaaagatag

DBGET integrated database retrieval system