KEGG   Virgibacillus sp. SK37: X953_17390Help
Entry
X953_17390        CDS       T03219                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00240  Pyrimidine metabolism
vir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    X953_17390
Enzymes [BR:vir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     X953_17390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK DNA_ligase_ZBD IMPDH
Motif
Other DBs
NCBI-ProteinID: AIF44681
UniProt: A0A075JRK7
LinkDB All DBs
Position
complement(3354450..3355070)
Genome map
AA seq 206 aa AA seqDB search
MYVMKQSGWVEVICGSMFSGKSEELIRRVRRATYAKLSVRVFKPAIDDRYDDEAVVSHNG
SSTVARPVKSSDEILEQLHAEVDIIGIDEVQFFDENIVEVVDELANKGICVIVAGLDTDF
RGEPFGPMPKLMALSESVTKLNAICPICGSPASRTQRLINGKPASYDDPIILVGASESYE
PRCRHHHEVPNKPSNKIVKGLFKQIK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtaatgaaacaaagtggttgggtagaagtaatctgcggaagcatgttttctggt
aaatctgaagagttgattcgtcgcgttcgcagagcaacatatgcgaagctttctgttcgc
gtatttaaaccagctattgatgacagatatgatgacgaggctgttgtctcacataatggt
tcatcaactgtcgccagacctgtgaaaagctcagatgaaattttggaacaactccatgct
gaagtagatattatcggtattgatgaggtacaattttttgatgaaaatattgtagaagta
gtagatgaacttgcaaacaagggaatttgtgttatcgtcgccggccttgatacagatttt
cgtggagaaccatttggaccaatgccaaaattgatggcacttagcgagtcagtgacaaaa
ctgaatgctatttgtcctatctgcggttcgccagcaagtcggacacaacggttgataaat
ggaaaaccagcttcctatgatgatccgattattctcgttggggcctcagaatcttatgaa
ccaagatgtcgccatcaccatgaagttcccaataagcccagcaacaagattgtaaaggga
ttatttaaacagattaaataa

DBGET integrated database retrieval system