KEGG   Virgibacillus sp. SK37: X953_19240Help
Entry
X953_19240        CDS       T03219                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00620  Pyruvate metabolism
vir00680  Methane metabolism
vir01100  Metabolic pathways
vir01120  Microbial metabolism in diverse environments
vir01200  Carbon metabolism
Module
vir_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vir00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    X953_19240
  Energy metabolism
   00680 Methane metabolism
    X953_19240
Enzymes [BR:vir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     X953_19240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: AIF44965
UniProt: A0A075JTP4
LinkDB All DBs
Position
complement(3710881..3713631)
Genome map
AA seq 916 aa AA seqDB search
MTVTTDSNALLRRDVNMLGSILGEILVLHGGKELFDKVETIREMTKSIRKTYDADTYQTL
KNEISTLQPPMRQQVIRAFSIYFHLINIAEQNHRIRRRREYLLKEEESQSFSLEKTVSNV
KNYDLTNEDIQDVLNELSVELIMTAHPTEATKRTVLEIQKRISEILRKLDNPQTTKNERA
YVEESLFNEVTALWHTDELRHRKPDVLDEVKNGLYYFDQTLFHTLPDVFQDLEMQLQSQI
SEEDWKVPNFIQFGSWIGGDRDGNPNVTPEITWKTLGMQRELILKKYDSTIVDLMRRFSQ
SSERITINPQFIEKVEQEEGTYLVDKEKWPVKSEVYRRKFAIILKRLRETGKTENGYQFS
EELANDLIEIKEHAEAHLPKPKKLKTLRKAIRQVQMFGFHLATLDVRNHSGEHEAAIHEI
LKAVHVADDYSNLTEEEKQKILLEVLNDQRPLLLFDGSYSEATQKMLRVFRMIKKAHEEF
GKRAIEVYLISMTEAPSDLLEVMVLAKEAGIYRLYPDGSVESDIDVAPLLETIDDLIAGP
KIMQTLFDTDVYRKQLQSRNRRQEIMLGYSDGSKDGGTLSANWRLFKAQLEIHNTAREYD
IRLKFFHGRGGSLGRGGGSLNTSILSQPMETLGDGVKITEQGEVLSSRYLLEDIAYRNLE
QAAAALFEACAKVSSSSDQVELRQKEWEDAMEAISEKSLRKYQSLVFGDPDFLTYFNQAT
PLTELGALNIGSRPMSRKNSQRFEDLRAIPWVFAWTQSRHMLPAWYAAGTGLQSFIEENG
SNLEILQTMYKEWSFFHSTINNLQMALMKADMKTAKEYLELVEDPVLANRIYEDIAEEYE
RTKKALLQISGNEELLSHTSNIKESVHLRNPYVDPLNFLQVDLIQKLRETSNPSEELVTE
VLLTINGVAAGLVNTG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaacgactgacagcaatgcattacttcgacgagatgtgaatatgctcggcagt
attttgggggaaattttagtactccatggtggcaaggagctatttgataaagtagaaaca
attcgggaaatgacgaaaagtattcgtaaaacatatgatgcggatacgtatcaaacacta
aaaaatgaaattagcactctacagccgcctatgagacagcaggtgattagagctttttct
atttattttcatttaattaatattgcggaacaaaatcatcgtattcgccggagacgcgag
tatttattgaaggaggaggagagtcagtccttctctttggaaaagacagtatccaacgtg
aaaaactatgacctcacaaatgaggatattcaggacgtacttaatgaattatctgtggaa
ctaattatgacagcacatccgaccgaggcgaccaagcgtaccgtgttagaaatccaaaaa
cgaatttctgaaattttacggaagttagacaatccacaaacaacaaaaaatgagcgtgca
tatgtggaggaaagtttatttaatgaggttacagcattatggcatacagatgaactgcgc
catcggaaacctgacgtgcttgatgaagtgaaaaacggtctttattattttgatcaaacg
ttattccatacattaccagacgtttttcaggatctggagatgcagcttcaatcccaaatt
tctgaggaggactggaaggtaccaaactttattcagtttgggtcgtggattggcggtgac
cgggatggtaatccaaatgtaacgcctgaaattacgtggaagacgttggggatgcaacgg
gagcttattttgaagaaatacgatagcaccattgttgatctaatgagacgttttagtcag
tcaagtgaacgtattaccattaaccctcaatttattgaaaaggtagagcaagaggagggt
acctatttagtagataaagaaaaatggccagtgaagtccgaggtatatcgccgtaagttt
gccattattttaaagcggctacgggaaacaggaaaaacggaaaacggctatcagttttcg
gaggagctggcaaatgatcttattgaaattaaggagcatgcagaggcacacctgccgaaa
ccgaaaaagctgaagacacttcgtaaggcaattcgccaggtgcagatgtttggtttccat
ctggcaacccttgatgtgcggaaccatagtggggagcatgaagctgctatccatgagatt
ttgaaggcagtacatgtagcagatgattattctaacttgaccgaagaggaaaagcagaaa
attctcctcgaggttctaaatgatcaacgcccattactactgtttgatggcagttattct
gaggcaacacaaaagatgttgcgtgtattccggatgattaaaaaagcccatgaagagttt
ggtaagcgtgcaattgaagtttatttaattagcatgacggaagcaccgagtgacctattg
gaagtcatggtactagctaaagaagcgggtatctatcgactttatccggatggaagtgta
gaaagtgacattgatgttgcaccacttttagaaacaattgatgatctgattgcaggtccg
aaaattatgcagacattattcgatacagatgtatatcggaaacagctccaatcacgcaac
agacgtcaggaaatcatgctcggctactcggatggaagtaaggatggcggtacattaagt
gcaaactggcgattatttaaagcacagttggaaattcataatacagcaagagaatatgat
atccgtctgaagtttttccatggtcgtggtggttcattaggccgtgggggcggttcttta
aatacaagtattctttcccaaccaatggaaactttgggcgatggtgtgaaaattacggag
caaggagaagtactttcctccaggtatttacttgaagatatcgcctatcgtaatctggag
caagctgctgcagccttatttgaagcgtgtgccaaggtgtccagttcttctgaccaggtt
gaactgcgtcaaaaagaatgggaggatgccatggaggctatttcagaaaaatccctaaga
aaataccaatcgctcgtgtttggcgaccctgattttctgacgtatttcaatcaggcaact
ccgttaacagagttaggtgctttaaatattggttcacgaccaatgagccggaaaaacagt
cagcgttttgaggatttgcgggcaattccgtgggtattcgcctggacgcaatccagacat
atgctccctgcttggtatgcagcgggaacaggtttgcaatccttcattgaagagaatgga
agtaacttagaaattttgcaaacaatgtataaggagtggtccttcttccattccactatt
aataacttacagatggccttgatgaaagctgatatgaagactgcgaaggaatatttagag
ttggtagaggatcctgtgttggcaaatcggatttatgaagatattgccgaggagtatgaa
cgtacgaagaaggcgctgctgcagatttccggaaacgaagagctgctaagtcacacgtct
aatataaaagagtccgtgcatcttcgtaatccatatgttgatccacttaatttcctgcag
gttgatttgatccaaaagctaagagaaacgtcaaatccatccgaagaactggtgacagaa
gtgttacttacaattaatggtgttgctgcaggtttagtgaatacaggttga

DBGET integrated database retrieval system