KEGG   Vitreoscilla sp. C1: ADP71_00960Help
Entry
ADP71_00960       CDS       T05336                                 

Definition
(GenBank) beta-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00061  Fatty acid biosynthesis
vit00780  Biotin metabolism
vit01100  Metabolic pathways
vit01212  Fatty acid metabolism
Module
vit_M00083  Fatty acid biosynthesis, elongation
vit_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ADP71_00960
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ADP71_00960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vit01004]
    ADP71_00960
Enzymes [BR:vit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ADP71_00960
Lipid biosynthesis proteins [BR:vit01004]
 Fatty acid synthase
  Component type
   ADP71_00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AUZ03940
UniProt: A0A2L0PIF5
LinkDB All DBs
Position
77676..78062
Genome map
AA seq 128 aa AA seqDB search
MLLDRVIAFEANQTLTAIKNVTMNEPFFQGHFPEFPVMPGVLITEALAQACGTLAILSEG
GRNEDEIYFFAGIDNARFKRQVIPGDQLVFEVELVQSKRGIGKFKAVAKVDGQVAAEAEI
MCAKRKVG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcttgatcgagtgattgcatttgaagccaatcaaactttgacagccattaaaaac
gtcaccatgaatgagccttttttccaaggtcatttcccggaatttccagtgatgccaggt
gtcttaattactgaagccttggcacaagcttgtggtactttggccattttgtccgaaggc
ggtcgcaacgaagacgaaatttatttctttgctggtattgataatgcacgctttaaacgc
caagtgattccaggtgatcaattggtatttgaagtggaattggtacaaagcaaacgtggt
attggcaaattcaaagctgtggccaaagtagatgggcaagtggcagctgaagctgaaatc
atgtgcgccaaacgcaaagtgggttag

DBGET integrated database retrieval system