KEGG   Vitreoscilla sp. C1: ADP71_25490Help
Entry
ADP71_25490       CDS       T05336                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00550  Peptidoglycan biosynthesis
vit01100  Metabolic pathways
vit01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ADP71_25490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ADP71_25490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ADP71_25490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vit01011]
    ADP71_25490
Enzymes [BR:vit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ADP71_25490
Peptidoglycan biosynthesis and degradation proteins [BR:vit01011]
 Precursor biosynthesis
  Amino acid ligase
   ADP71_25490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AUZ05864
UniProt: A0A2L0PNU5
LinkDB All DBs
Position
complement(1935120..1936031)
Genome map
AA seq 303 aa AA seqDB search
MQHLGKVAVLLGGESTEREVSLNSGNAVYQALLSAGVDAHLFDTKEQSLFALKDLGFDRV
FIVLHGGAGEDGRVQAVLETMGLPYTGCGVAASAIGMDKLRTKLIWKALDLPVPDFAVLQ
DDTDFAAVEARLGLPMFVKPSAEGSSVGVVKVSTTGQLPAVYQELKQYRGAVIAEAFIGG
GEYTCAILGNEALPTIKIVPATEFYDYEAKYARDDTQYLCPSDLSAEDEALMRELSLQAF
AAIDGRGWGRVDFLRGVDGQLYVLEANTVPGMTSHSLVPKAALQTGRSFSQLCVEILEHA
TLG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacttaggtaaagtcgcggtattattgggtggagagtccactgagcgtgaagtg
tctttgaacagtggcaatgcggtttaccaagctttgttgtcagcaggtgtggatgcacat
ttgtttgataccaaagagcaatctttgtttgctttgaaagatttgggttttgatcgtgtg
ttcatcgttttgcatggtggcgcgggtgaagatggtcgtgtgcaagcggtattggaaact
atgggcttgccttatacaggttgtggtgtggctgcttctgccattggtatggacaaattg
cgcaccaaattgatttggaaagctttggatttgcctgtgcctgattttgcagtgttacag
gacgatactgattttgccgcagtggaagcgcgcttgggtttgcctatgtttgtgaagcct
agcgcggaaggtagcagtgttggtgtggtgaaagtatcaaccacgggtcaattgcctgcg
gtataccaagagctcaaacaataccgtggtgcggtgattgcagaagcatttattggcggt
ggtgagtatacttgtgctattttgggcaatgaagcattgcctaccattaaaattgtgcct
gccactgagttttatgattacgaagctaaatatgcacgtgacgatactcaatatttgtgc
ccatcggatttgagcgcagaagacgaagctttgatgcgtgaattgtctttgcaagcattt
gctgcgattgatggtcgaggttggggacgtgtggattttttacgtggtgtagatggacaa
ttgtatgtgttagaagccaatacagttcctggtatgacgtctcatagcttagtgcctaaa
gctgctttgcaaacaggtcgtagtttttctcagttgtgtgtggaaatcttagaacatgcg
actttgggatga

DBGET integrated database retrieval system