KEGG   Vitreoscilla sp. C1: ADP71_28170Help
Entry
ADP71_28170       CDS       T05336                                 

Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vit00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ADP71_28170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vit02000]
    ADP71_28170
Enzymes [BR:vit01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ADP71_28170
Transporters [BR:vit02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ADP71_28170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_29 AAA_15 AAA_23 RsgA_GTPase AAA_22 AAA_21 Rad17 AAA_16 G-alpha AAA_28 AAA_33 AAA_25 AAA_30 SMC_N AAA_7 Mg_chelatase AAA_27 AAA_24 AAA_5 NB-ARC RNA_helicase AAA_14 TniB PRK NACHT ATPase_2 PPV_E1_C Adeno_IVa2 Viral_helicase1 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AUZ06065
UniProt: A0A2L0PPK9
LinkDB All DBs
Position
2155460..2155684
Genome map
AA seq 74 aa AA seqDB search
MTAKISAKDFNFYYGDFHALKNINLDIAEKKVTAFIGPSGCGKSTLLRTFNRMYDLYPGM
RAESYSHFWCMTNK
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgactgctaagatttctgcaaaagactttaacttttactacggtgattttcacgctcta
aaaaacatcaatttggatattgcagagaaaaaagtcaccgccttcattggcccatctggt
tgcggcaaatcgactttattgcgcacattcaaccgtatgtacgacttatatcccggcatg
cgcgctgagagctatagtcatttctggtgtatgacgaacaaatga

DBGET integrated database retrieval system