KEGG   Verrucosispora maris: VAB18032_00465Help
Entry
VAB18032_00465    CDS       T01471                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
vma  Verrucosispora maris
Pathway
vma00020  Citrate cycle (TCA cycle)
vma00480  Glutathione metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
vma01210  2-Oxocarboxylic acid metabolism
vma01230  Biosynthesis of amino acids
Module
vma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vma_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAB18032_00465
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VAB18032_00465
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VAB18032_00465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AEB47177
UniProt: F4FB32
LinkDB All DBs
Position
complement(5784209..5785426)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVNNPVVELDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAISEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYRATDFVVPGPGKVTITYTPADGAQPIEMEIANFPGSGIAMG
MYNYDDSIRDFARASFRYGLDRGYPVYMSTKNTILKAYDGRFKDIFAEVFENEFKAEFDA
AGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGR
TVEAEAAHGTVTRHYRQWQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVTEFANTLEQ
VIVDTVESGQMTKDLALLISRDAPWLTTDEFMNTLDENLARRLAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtggagctcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgcgacgccaccgacgaccaggtgaccgtcgacgcc
gccaacgccatctccgagcacggcgtcggcgtcaagtgcgcgaccatcaccccggacgag
gcccgggtggaagagttcgggctgaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggcggcgtcgtcttccgcgagccgatcatcatgtccaacgtgccgcggctc
gtccccggctggaccaagccgatcatcatcggccggcacgcccacggcgaccagtaccgc
gccaccgacttcgtcgtgcccggccccggcaaggtgaccatcacctacaccccggccgac
ggcgcgcagcccatcgagatggagatcgccaacttcccgggcagcggcatcgcgatgggc
atgtacaactacgacgactcgatccgggacttcgcccgggcgtcgttccggtacggcctg
gaccgcggctacccggtctacatgtccaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaagacatctttgccgaggtgttcgagaacgagttcaaggcggagttcgacgcc
gccggcctcacctacgagcaccggctcatcgacgacatggtcgccgccgcgctcaagtgg
gagggtggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtcctgctctcgcccgacggccgc
accgtcgaggccgaggccgcccacggcaccgtcacccggcactaccggcagtggcagaag
ggcgagaagacctcgaccaacccgatcgcctccatctacgcctggacccggggcctggcc
caccggggcaagctggacggcaccccggcggtcaccgagttcgccaacacgctggagcag
gtcatcgtcgacaccgtcgagagcggccagatgaccaaggacctcgcgctgctcatctcg
cgggacgccccgtggctgaccaccgacgagttcatgaacacgctcgacgagaacctggcg
cgccgcctcgccgcctga

DBGET integrated database retrieval system