KEGG   Verrucosispora maris: VAB18032_06515Help
Entry
VAB18032_06515    CDS       T01471                                 

Definition
(GenBank) DNA polymerase LigD ligase subunit
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    VAB18032_06515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vma03400]
    VAB18032_06515
Enzymes [BR:vma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VAB18032_06515
DNA repair and recombination proteins [BR:vma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VAB18032_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEB42427
UniProt: F4FDR4
LinkDB All DBs
Position
415729..416637
Genome map
AA seq 302 aa AA seqDB search
MTGQLPVGAGWAYEFKWDGVRALADITAGRQHLYARSGVEITAAYPELITLAEQVDDALL
DGEVVLFDQAGRPSFTALAERMHVRDRAKAARLAASVPVTYMIFDLLRLRGEDLTGWPYA
RRREALDDLGLGAARWAVPPVFFDGAATYSAAGEHGLEGVMAKRVDSTYRPGVRSPDWVK
VKLEVTGDFVVGGWRPGARRIGGLLVGVPGAGGRLTYRGRVGGGIGAAIERELLRELEPL
RTPTSPFAAGVPREDARGAIWVTPQVVVEVKYGQRTPDGRLRFPRILRLRPDKPAEEVDD
AS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcaactcccggtcggtgccggctgggcgtacgagttcaagtgggacggcgta
cgcgccctggccgacatcaccgctggtcggcagcacctgtacgcccgctccggtgtggag
atcaccgccgcctacccggaactgatcacgctcgccgagcaggtcgacgacgcactgctc
gacggtgaggtggtcctcttcgaccaggcgggacgcccgtcattcaccgcactcgcggag
aggatgcacgtgcgggaccgggcgaaggcggcccggctggcggcgagcgtccccgtcacg
tacatgatcttcgacctgctccggttgcggggcgaggacctcaccggctggccgtacgcc
cgccgccgggaggccctcgacgacctgggcctgggtgcggcgcggtgggcggtgccaccg
gtcttcttcgacggcgcggccacctactccgccgccggtgagcacggcctggagggggtg
atggccaagcgggtcgactcgacctaccgacccggggtgcgctcaccggactgggtgaag
gtcaaactggaggtgacaggcgacttcgtggtcggtggctggcggcccggcgcccgcagg
atcggtgggctgctggtcggggtgcccggtgccggcggacggctcacctaccggggtcgg
gtcggcggcggcatcggcgcggcgatcgaacgggaactgctgcgcgagctggagccactg
cgcacccccacctcaccgttcgccgccggcgtgccgcgcgaggatgcccggggcgcgatc
tgggtaaccccacaggtggtggtggaggtgaagtacggccagcgcaccccggacgggcga
ctgcggttcccccggatcctgcggctgagaccggacaagccggccgaggaggtcgacgat
gccagctga

DBGET integrated database retrieval system