KEGG   Verrucosispora maris: VAB18032_06520Help
Entry
VAB18032_06520    CDS       T01471                                 

Definition
(GenBank) DNA polymerase ligd, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    VAB18032_06520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vma03400]
    VAB18032_06520
Enzymes [BR:vma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VAB18032_06520
DNA repair and recombination proteins [BR:vma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VAB18032_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB42428
UniProt: F4FDR5
LinkDB All DBs
Position
416627..417541
Genome map
AA seq 304 aa AA seqDB search
MPAERFRVEVEGRTLDLSNLDKVLYPQAGFTKGEVIDYYTRIAPVLLPHLADRALTRIRY
PNGVDGNSFFEKNAPAATPSWVRTENLPAPGSSKGRETIDYVVADDLPTLVWLANLAALE
LHTPQWKVGEHPDLMVVDLDPGAPASLKQCCQVALLLRDRLAADGVDAYPKTSGKKGMQL
SCPIAGTQSSDDVSGYARRIAQELEREHPKLIVSKMAKNLRPGKIFIDWSQNNAAKTTVA
PYSLRAQPVPSVSAPLTWDEVAAGAAGKRPSSRPYTAGEVLKRVDEHGDLLAPLLDLGPA
LPER
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgagcgcttccgggtcgaggtcgagggccgcaccctggacctgtccaacctg
gacaaggtgctctatccacaggccggcttcaccaagggcgaggtgatcgactactacacc
cggatcgccccggtgctgctgccgcacctggccgaccgggcgctgacccggatccgctac
ccgaacggggtggacggcaactcgttcttcgagaagaacgcccccgccgcaaccccctcc
tgggtgcgcaccgagaacctgcccgcccccggatcgagcaagggccgggaaaccatcgac
tacgtggtcgccgacgacctgcccaccctggtctggctggccaacctcgccgcgctggaa
ctgcacaccccgcagtggaaggtcggcgaacaccccgacctgatggtggtcgacctcgac
ccgggcgccccggcgtccctcaagcagtgctgccaggtggcgctgctgctgcgcgaccga
ctcgccgccgacggggtggacgcctacccgaagacctccggcaagaagggcatgcaactg
agctgcccgatcgccggcacccagtcctccgacgacgtgtcgggctacgcccgacggatc
gcgcaggagttggaacgcgaacacccgaagctgatcgtgtcgaagatggcgaagaacctg
cgacccggcaagatcttcatcgactggagtcagaacaacgcggcgaagacgactgtcgcg
ccgtactcgctgcgcgcccagccggtgccgtccgtctccgcgccgctgacctgggacgag
gtcgccgccggtgcggccggcaagcgcccgtcgtcccggccgtacaccgccggcgaggtg
ctcaagcgggtcgacgaacacggcgacctgctcgcccccctgctcgacctcggccccgca
ctgcccgagcggtaa

DBGET integrated database retrieval system