KEGG   Verrucosispora maris: VAB18032_09140Help
Entry
VAB18032_09140    CDS       T01471                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vma  Verrucosispora maris
Pathway
vma00620  Pyruvate metabolism
vma00680  Methane metabolism
vma01100  Metabolic pathways
vma01120  Microbial metabolism in diverse environments
vma01200  Carbon metabolism
Module
vma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAB18032_09140
  09102 Energy metabolism
   00680 Methane metabolism
    VAB18032_09140
Enzymes [BR:vma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VAB18032_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: AEB42946
UniProt: F4F4I8
LinkDB All DBs
Position
complement(976597..979386)
Genome map
AA seq 929 aa AA seqDB search
MVTDQHDHDGPDAALRADIRRLGTLLGQTLARQEGRPLLDLVEEIRAQVRTDAPAAARRL
GGLDVTTGTKLARAFSTYFHLANITEQVHRARDLRRRRAVQGGWLDQAAKMISERGVPAE
EIAAVARRLAIRPVFTAHPTEAARRSILSKLRAIADELDTETANAILYGASDEGPANRRL
AELLDLMWQTDELRLDRPDPTDEARNAIYYLRDLYAEAAPQVLDDLAETLRTLGVETSPT
ARPLTFGTWIGGDRDGNPFVTPTVTREVLAIQHEHGLTATEAAMEELINEVSVSRRLRGV
SLDLSASLAADLDALPEVAPRFRRVNAEEPYRLKARCVRAKLANTRARLRQGTPHVPGRD
YRGSAELIADLELLRASLARNSGQLTAVGRLASTIRTVSAFGLHLATMDVREHAEKHHEV
LAQLYAAVGEVDDYPSLSRLERTKLLADELTGRRPLSAADTPLSESARKTFDVFSTIREA
QDRFGSEVIESYIISMTLGVDDVLAAVVLAREAGLVDVHSGRARIGIVPLLETPAELNAG
GELLDELLSLPAYRALVAARGDVQEVMLGYSDSNKEAGITTSQWSIHRAQRALRDVAARH
GVHLRLFHGRGGTVGRGGGPTHDAILAQPYGTLDGAIKVTEQGEVISDKYTLPALARENL
ELTVAAVLQATLLHTAPRQPAEMLERWDATMDVVSESAYRSYRSLVEDPDLPAYFWASTP
TELLGALNIGSRPAKRPNTGAGLSGLRAIPWVFGWTQTRQIVPGWYGVGSGLAAAREAGL
ADVLAEMHRNWHFFRTFLSNVEMMLTKTDLGIARRYVETLVPKKLHPIFDKIEAEYELTR
REVLAVTDSPDLLENSPVLQRTLAVRDTYLEPLHHLQVALLRQYRDSGAAGRAVVTAPGG
RRAPNDGTALERALLTTVNGIAAGMRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccgaccagcacgatcacgacggccccgacgccgccctgcgcgccgacatccgc
aggctgggcaccctgctcgggcagaccctggcgcgccaggagggtcggccgctgctcgac
ctcgtggaggagatccgcgcccaggtccgtaccgacgccccggccgccgcgcgccgcctc
ggcgggttggacgtgaccaccggcacgaagctggctcgcgccttctccacctacttccac
ctggccaacatcaccgagcaggtgcatcgggcccgcgacctgcgtcgacgtcgggccgtg
cagggtggctggctggaccaggcggccaagatgatctccgagcggggagtgccggcggaa
gagatcgccgcggtggcccgccggttggcgatccggccggtcttcaccgcgcacccgacc
gaggcggcccgccggtcgatcctgtcgaagctgcgcgccatcgccgacgagctcgacacc
gagaccgcgaacgcgatcctctacggtgccagtgacgagggcccggcgaaccgtcggctg
gccgagctgctcgacctgatgtggcagaccgacgagctgcggctggatcggcccgacccg
accgacgaggcccgcaacgccatctactacctgcgcgacctgtacgccgaggccgccccg
caggtgctcgacgacctcgccgagacgctgcgcacgctcggcgtggagacctcaccgacg
gcccgaccgttgaccttcggcacctggatcggcggcgaccgcgacggcaacccgttcgtc
accccgacggtcacccgcgaggtgctggccatccagcacgagcacgggctgaccgccacc
gaggcggcgatggaagaactgatcaacgaggtgtcggtgtcccgccggctgcgcggggtg
tcgctggacctgtccgccagcctcgccgccgacctggacgcgctgcccgaggtggccccc
cggttccgccgggtcaacgccgaggagccgtaccggctcaaggcccggtgcgtacgcgcc
aagctggccaacacccgcgcccggctgcgccagggcaccccgcacgtgccgggacgggac
taccggggctcggccgagctgatcgccgacctggagctgctgcgcgcctcgctggcccgc
aactccggtcagctgaccgccgtcgggcggctcgcctcgaccatccgtacggtctccgcg
ttcggcctgcacctggcgaccatggacgtgcgggagcacgccgagaagcaccacgaggtg
ctggcccagctgtacgcggcggtcggcgaggtcgacgactacccgtcgttgagccggctg
gagcgcaccaagctgctcgccgacgagctgaccggccgccgaccgctgtcggctgcggac
actccgctgtccgagtccgcccgcaagacgttcgacgtgttcagcaccattcgcgaggcg
caggaccggttcggcagcgaggtcatcgagtcgtacatcatctcgatgaccctcggggtc
gatgacgtgctcgccgccgtggtgctggcccgcgaggcgggccttgtcgacgtgcacagc
gggcgggcacgcatcggcatcgtgccgctgctggagacccccgccgagctgaacgccggt
ggtgagctgctcgacgagttgctgtcgctgcccgcgtaccgggcgctggtggcggcccgg
ggcgacgtgcaggaggtgatgctgggttactccgactccaacaaggaggccggcatcacc
accagccagtggtccatccaccgggcgcagcgggcgctgcgggacgtggccgcccggcac
ggtgtgcacctgcggctgttccacggccggggcggcacggtgggtcgtggcggtggcccc
acccacgacgcgatcctggcccagccgtacggcaccctcgacggcgcgatcaaggtgacc
gagcagggcgaggtgatctccgacaagtacaccctgccggcactggcccgggagaacctg
gagctgaccgtggccgccgtgctccaggccaccctgctgcacaccgcgccccggcagccc
gccgagatgctggagcgctgggacgccacgatggatgtggtctccgagtcggcataccgg
tcgtaccgctcgctcgtggaggatccggatctgccggcgtacttctgggcgtccacgccc
accgagttgctcggcgcgttgaacatcggctcccggccggcgaagcgcccgaacaccggg
gccgggctgtccggtctgcgggccatcccgtgggtgttcggctggacccagacccggcag
atcgtgcccggctggtacggcgtgggctccggcctggccgccgcacgcgaggccgggctg
gccgacgtgctggccgagatgcaccgcaactggcacttcttccgcacgttcctgtcgaac
gtggagatgatgctgaccaagaccgacctcggcatcgcccggcggtacgtggagaccctg
gtcccgaagaagctgcacccgatcttcgacaagatcgaggcggagtacgagctgacccgg
cgcgaggtgctggccgtcaccgactcaccggacctgctggagaactcccccgtgctgcaa
cgcaccctcgcggtgcgcgacacctacctggagccgctgcaccacctccaggtcgcgctg
ctgcggcagtaccgcgactccggtgcggccggtcgggcggtggtcaccgcaccgggcggc
cggcgggcccccaacgacggtacggcgctggaacgcgccctgctcaccaccgtcaacggc
atcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system