KEGG   Verrucosispora maris: VAB18032_09190Help
Entry
VAB18032_09190    CDS       T01471                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma00220  Arginine biosynthesis
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01130  Biosynthesis of antibiotics
vma01210  2-Oxocarboxylic acid metabolism
vma01230  Biosynthesis of amino acids
Module
vma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    VAB18032_09190
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     VAB18032_09190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_9 Acetyltransf_10 Acetyltransf_6 Acetyltransf_CG Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: AEB42956
UniProt: F4F4J8
LinkDB All DBs
Position
991685..992218
Genome map
AA seq 177 aa AA seqDB search
MTAEATQAVPDDIVIRRARTADVRAIRRLVDTYTDDRRLLSKATVTLYEDVQEFRVATRV
GDGRVVGCGALHVMWEDLAEIRTVAVDPSCRGRRIGHRIVAELIDAARELGVARIFVLTF
ETSFFASFGFTEIDGAPVPHAVYEQLLRSYDEGVAEFLDLERVKPNTLGNTRMLLRL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgaggcgacgcaggcggtgcccgacgacatcgtgatccggcgggcccgcacc
gccgacgtgcgggccatccggcggctggtggacacctacaccgacgaccgacggctgctc
agcaaggccaccgtgaccctctacgaggacgtgcaggagttccgggtggccacccgggtc
ggcgacggccgggtggtgggctgcggcgcgctgcacgtgatgtgggaggacctggccgag
atccgtaccgtcgccgtcgacccgtcctgccggggacggcggatcgggcaccggatcgtc
gccgagctgatcgacgcggcccgcgagctgggcgtggcccggatcttcgtactgaccttc
gagaccagcttcttcgcctcgttcggcttcaccgagatcgacggtgcgccggtcccgcac
gcggtctacgagcagctgctgcgctcctacgacgagggtgtcgccgagttcctcgacctg
gagcgggtcaagccgaacaccctgggcaacacccggatgctgctgcggctctga

DBGET integrated database retrieval system