KEGG   Verrucosispora maris: VAB18032_11395Help
Entry
VAB18032_11395    CDS       T01471                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vma  Verrucosispora maris
Pathway
vma00473  D-Alanine metabolism
vma00550  Peptidoglycan biosynthesis
vma01100  Metabolic pathways
vma01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAB18032_11395
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAB18032_11395
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VAB18032_11395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vma01011]
    VAB18032_11395
Enzymes [BR:vma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VAB18032_11395
Peptidoglycan biosynthesis and degradation proteins [BR:vma01011]
 Precursor biosynthesis
  Amino acid ligase
   VAB18032_11395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEB43395
UniProt: F4FAG8
LinkDB All DBs
Position
1489595..1490701
Genome map
AA seq 368 aa AA seqDB search
MTTPGKTRVAIVFGGRSPEHGISCVSAGSVLGALDPDEFEVVPVGITRAGQWVLTSGDPT
ELAINSRRLPEITAESGADIVLRADPTGSGLLVLDPTEGPRALANVDVVFPVLHGAYGED
GTIQGMLEMAGIPYVGAKVFASAAAMDKEFTKKICAAEGIPIGPYAVLRSGMTLSEEDKQ
RLGLPVFVKPSRAGSSFGVSKVSDWADLEAAIAIAREIDSKVLVEGAIIGREIECGVLEG
EAGGTPEASVLAEVRVVGDYDFYDFEAKYIDAESACEYDVPADLPERVARQVRDYAVRAF
TALDCAGLARADFFVTPELDIYLNEINTMPGFTPTSMFPRMWAASGLEYPKLVDRLIRTA
LTRGTGHY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccaggcaagacccgcgtggcgatcgtcttcggcggccgcagcccggaacat
ggcatctcctgtgtgagcgccggcagcgtgctcggcgcgctcgaccccgacgagttcgag
gtggtgccggtcggcatcacccgggcgggtcagtgggtgctgaccagcggcgacccgacc
gagttggcgatcaactcgcgccggctgccggagatcaccgccgagtcgggggccgacatc
gtgctgcgagccgacccgaccggcagcggcctgctggtgctcgaccccaccgaagggcct
cgggcactggccaatgtggacgtggtcttcccggtgctgcacggcgcctacggcgaggac
ggcaccatccagggcatgctggagatggcgggcatcccgtacgtgggggcgaaggtgttc
gcctcggccgccgcgatggacaaggaattcaccaagaagatctgcgccgccgagggcatc
ccgatcggcccgtacgccgtgctgcgtagtggcatgacgttgagcgaggaggacaagcag
cgcctcggcctgccggtcttcgtcaagccctcgcgggccggatcgtcgttcggcgtcagc
aaggtcagcgactgggccgacctggaggccgcgatcgccatcgcccgggagatcgacagc
aaggtgctggtcgagggcgcgatcatcggccgggaaatcgagtgcggcgtgctggagggc
gaggccggcggcacgcccgaggcgtccgtgctggccgaggtgcgggtggtcggcgactac
gacttctacgacttcgaggccaagtacatcgacgcggagtcggcctgcgagtacgacgtc
ccggccgacctgcccgagcgggtcgcccggcaggtgcgcgactacgccgtacgggccttc
accgcgctggactgcgccggactggcccgggccgacttcttcgtcaccccggaactggac
atctacctcaacgagatcaacacgatgccgggcttcaccccgacgtcgatgttcccccgg
atgtgggcggcctcggggctggagtacccgaagcttgtcgaccggctcatccgtaccgcc
ctgacccggggcaccggccactactga

DBGET integrated database retrieval system