KEGG   Verrucosispora maris: VAB18032_12830Help
Entry
VAB18032_12830    CDS       T01471                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
vma  Verrucosispora maris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEB43680
UniProt: F4FEW8
LinkDB All DBs
Position
complement(1793502..1794659)
Genome map
AA seq 385 aa AA seqDB search
MICLTVVGGVWLTVAVDLPINPPVEPMLARSVASIPTGPGMTYEPKWDGFRCIIFRDGDE
VELASRGGKLMTRYFPEVVEQARRQLPARCAVDGELIVIRRDSPNAAPRLDFELLAQRIH
PAASRVKLLAETTPADFVAFDLLALDGESLLDVPYPTRRARLEQALAKVRPPVHVTQITT
DADTARRWFDVFEGAGLDGLIAKPADLPYEPGKRLMFKVKHARTADVVVAGFRWHKSGPV
VGSLLLGLYDDAQVLHHIGVSASFTMARRAELLEELAPYREVGAEHPWVHGDHERGQRIP
GGVSRWTGTKNLEWEPLRPELVVEVAYDAMEGDRFRHTARFVRWRPDRDPLSCRYDQLDR
PVRFDVDQVLRGDPTVTVGSGTGSA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgatctgcctcaccgttgtcggtggggtctggttgactgtcgccgtggacctgccgatc
aacccgccggtggagccgatgctcgcccgcagcgtcgcgtcgatccccaccgggccgggc
atgacctacgaacccaagtgggacggtttccgctgcatcatcttccgcgacggcgacgag
gtggagctggccagccggggcggcaagctgatgacccgctacttccccgaggtggtcgag
caggcccgccgacagttgccggcacgctgcgcggtcgacggcgagctgatcgtgatccgc
cgcgacagcccgaacgccgcgccccggctcgacttcgagctgctggcccaacgcatccac
ccggccgcctcccgggtgaagctgctcgccgagaccacgcccgccgacttcgtcgccttc
gacctgctcgccctcgacggcgagagcctgctcgacgtgccctacccgacccgacgcgct
cggctggagcaggccctggccaaggtccgcccgccggtgcacgtcacccagatcaccacc
gacgccgacaccgcccgtcgctggttcgacgtgttcgagggcgccgggctggacgggctg
atcgccaaacccgccgacctgccctacgagccgggcaagcggctcatgttcaaggtcaag
cacgcccgcaccgcggacgtggtggtcgccgggttccgctggcacaagtccggcccggtg
gtcggctcgctgctgctcgggctctacgacgacgcgcaggtgctgcaccacatcggggtg
agcgcctcgttcaccatggcccgccgggccgagttgctggaggagctggccccctaccgc
gaggtcggagccgaacacccgtgggtgcacggcgaccacgagcgcggccaacgcatcccg
ggcggggtcagccggtggaccggcaccaagaacctggaatgggagccgctgcgcccggag
ctggtggtcgaggtggcctacgacgcgatggagggtgaccggttccggcacaccgcccgg
ttcgtccgctggcggcccgaccgcgacccgctctcctgccggtacgaccagttggaccgg
ccggtccggttcgacgtggaccaggtcctgcgcggcgatccgacggtgacggtcgggtcc
ggcaccggctccgcgtag

DBGET integrated database retrieval system