KEGG   Verrucosispora maris: VAB18032_17465
Entry
VAB18032_17465    CDS       T01471                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
vma  Verrucosispora maris
Pathway
vma00362  Benzoate degradation
vma00622  Xylene degradation
vma00643  Styrene degradation
vma01100  Metabolic pathways
vma01120  Microbial metabolism in diverse environments
vma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAB18032_17465
   00622 Xylene degradation
    VAB18032_17465
   00643 Styrene degradation
    VAB18032_17465
Enzymes [BR:vma01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     VAB18032_17465
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Abhydrolase_2 PGAP1 BAAT_C Abhydrolase_5 Thioesterase Lipase_3 Peptidase_S15 Abhydrolase_4 Ser_hydrolase DUF2974
Other DBs
NCBI-ProteinID: AEB44595
UniProt: F4F9L7
LinkDB
Position
2830739..2831560
AA seq 273 aa
MTALRTVTVHGSPVHLMESGTGPAVLMLHGSGPGTTGSGAWAATAQALGTSWHFVAPDQA
GFGRTPVPPGSRGGLRLWTEQAAGLMDALGIEHYTVVGHSMGGAVALALAAARPQQVTRV
VAVSTMGAPGAPLSADLDAIWAVPASVLGARDMLSRLVLDQTLVTDAAVDARAAAMRAGA
DAFASLFPPPRARWADDLSLSAQTLAAIRAPVLLVHGAEDRVTPLETAAQPLLAHLPDVR
LHVFGRCGHVPAIEHPHEFRQLLSCFLHPDLCP
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacggcacttcggaccgtcacggtccacggctctcccgtccacctcatggagagcggc
accggacccgcggtgctgatgctgcacggctccggacccggcacgaccgggtccggagcc
tgggcggccaccgcgcaggcgctgggcacgtcctggcacttcgtcgctcctgaccaggcc
gggttcggccgcacacccgtcccacccggctccaggggcgggctccggctgtggacggag
caggccgcaggcctcatggatgctctcggtatcgagcactacaccgtggtgggtcactcc
atgggcggtgccgtggcactggcgttggcggccgcccgcccccagcaggtcacccgggtc
gtggcagtctcgacgatgggcgcccccggcgcgccgctgtccgccgacctcgacgcgatc
tgggccgtacccgccagcgtgctcggcgcacgagacatgctgagtcgcctcgtcctcgac
cagacgctcgtgaccgatgcggccgtcgatgcccgcgcggccgcgatgcgagcgggggcg
gatgcattcgcctcgctgttcccgccaccccgggcacgatgggccgacgacctcagcctc
tccgcgcagacgctggcggcgatccgcgcgcccgttctgctcgtccacggcgctgaggac
cgggtcaccccgctcgaaacggcagcccagcctctcctcgcacacctgcccgatgtccgt
ctgcacgtgttcggccgatgcgggcacgtgccggcgatcgagcacccgcacgagttcagg
caactgctgtcctgcttcctccacccggacctctgcccctaa

DBGET integrated database retrieval system