KEGG   Verrucosispora maris: VAB18032_19480Help
Entry
VAB18032_19480    CDS       T01471                                 

Definition
(GenBank) threonine dehydrogenase
Organism
vma  Verrucosispora maris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AdoHcyase_NAD AlaDh_PNT_C HI0933_like Pyr_redox NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AEB44998
UniProt: F4FF93
LinkDB All DBs
Position
3322373..3323398
Genome map
AA seq 341 aa AA seqDB search
MNRSAYYVGDQTFVVKEADPVPPGPGQVRIEVAYTGICGTDLHIAHGAMDQRVQRPAVIG
HEMSGRIAELGAGVEGHRVGDPVTVMPLDWCGDCPACRAGHTHICHRLNFVGIDSPGAMQ
QSWTVPARILVPLPEGLSLAHAALVEPTAVAVHDVRRSRLAAGEHAVVIGAGPVGLLIGT
VARTTGAQVTVLELDPRRRQLAADLGLSAVDPATVDVAGYVHEVTGGAGAEVVYEVSGSA
AGVRTATDLLAVRGRLVVVAIHPAPREVDLHRIFWRELEVIGVRVYERADYVEAVRLVHG
GQVPVDRLISRIVPLTEVAQAFEALATGGDVKVLIDCGGDA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcagcgcgtactacgtcggcgaccagaccttcgtcgtcaaggaggccgacccg
gtgccgcccggtcccgggcaggtccgcatcgaggtcgcctacaccgggatctgcggcacc
gacctgcacatcgcccacggcgcgatggaccagcgggtccagcgaccggcggtgatcgga
cacgagatgtcgggccgtatcgcggagttgggcgcgggtgtcgagggccacagggtgggg
gacccggtgacggtgatgccgctggactggtgcggcgactgtcccgcctgccgtgccggg
cacacccacatctgtcaccggctcaacttcgtcggcatcgactcgcccggcgcgatgcag
cagtcctggacggtgccggcgcggatcctggtgccgctgcccgaagggctgtccctggcc
cacgccgcgctggtggagccgactgcggtggccgtgcacgacgtacggcggtcccgcctg
gccgccggtgaacacgcggtggtcatcggcgccggcccggtcgggctgctcatcggcacc
gtcgcgcggacgaccggtgcccaggtgaccgtgctcgaactcgacccgcggcggcgtcaa
ctcgccgccgacctcggcctgtccgcggtggatcccgcgacggtcgacgtcgccggctac
gtccacgaggtgaccgggggcgccggtgccgaggtggtgtacgaggtgtcgggatcagcc
gccggtgtccgtacggcgacggacctgctcgccgtacgcgggcggttggtcgtggtggcg
atccaccccgccccccgcgaggtggacctgcaccggatcttctggcgcgagctggaggtg
atcggcgtacgcgtctacgagcgcgcggactacgtcgaggcggtccgtctggtgcacggt
ggtcaggtgccggtcgaccgactgatctcccgcatcgtgccgttgaccgaggtggcgcag
gcgttcgaggcactggccaccggtggcgacgtcaaggtgctcatcgactgtggaggagac
gcgtga

DBGET integrated database retrieval system