KEGG   Verrucosispora maris: VAB18032_24830Help
Entry
VAB18032_24830    CDS       T01471                                 

Definition
(GenBank) beta-ketoacyl synthase
  KO
K15320  6-methylsalicylic acid synthase [EC:2.3.1.165]
Organism
vma  Verrucosispora maris
Pathway
vma01059  Biosynthesis of enediyne antibiotics
vma01100  Metabolic pathways
vma01130  Biosynthesis of antibiotics
Module
vma_M00829  3,6-Dimethylsalicylyl-CoA biosynthesis, malonyl-CoA => 6-methylsalicylate => 3,6-dimethylsalicylyl-CoA
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    VAB18032_24830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vma01008]
    VAB18032_24830
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.165  6-methylsalicylic-acid synthase
     VAB18032_24830
Polyketide biosynthesis proteins [BR:vma01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal partially reducing PKS (PR-PKS)
    VAB18032_24830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB46064
UniProt: F4FD34
LinkDB All DBs
Position
4510619..4515790
Genome map
AA seq 1723 aa AA seqDB search
MSLEPIAIVGMACRFAGGIDSPDAFWEMLCDGRDAVGDLPAGRWDWYAQQGREHATAVRS
ATSRGAFLDDIAGFDADFFGVTPREATLMDPQQRMVLELAWEALEHAGIPPGQLAGTDTG
VYVGVGADDYGRRMLEDLPRIEAWTGVGGGYCGVANRVSYLLDLRGPSMVLDTACSSSLV
AVHLAAQALRNGECPVALAGGVLVIAAPGLSLVLDAAGATAPDGRSKAFDAAADGYGRGE
GGGVVVLKRLADARRDGDRVLAVLRGSAVHQDGRTDGIMAPSAQAQAHLLRRAYQNAGVD
PSTVGYVEAHGTGTRAGDPLEAQAMSAVLGAGRPADRPLLIGSAKTNIGHLEAGAGVAGL
IKAVLTLRHGVIPPSLHVHTPNPAIPWDTAGLKVVTELTPWVQTEGPRRAGVCGYGYGGT
IAHVILEAADEQPAADEQSATDVPDPATPQPALYPLSGASAAAVGQYAARLADRLDRPHP
PALADVGYTLARRRDELPYRATVVAADRTELVERLRALAAPSGVGEIGRASAPAGRGVVW
VFSGHGSQWIGMGRELLHAEPVFAEVLDELEPIFQAELDVSPGAALRAQTAHPVDVIQPL
IFAVQVALAAVLRAHGAHPAAVLGHSVGEIAAAVTAGLLTREQGARLVCRRSVLLRRVAG
QGAMAMVDLPPEEAEQRLTDDGDVCVAIAASPVATVISGSAAAVRAVSRRWADEGLDVRM
VDSDVAFHSSQMDELTADLAAACADLPPAEVPTVAVYSTASTDSRTAAPRDGAYWAANLR
EQVRLAQAVEAAAADGYRLFLEVSAHPVVTHSIAETLDLLGVEDTLVAHTLRRHRPERES
LLGAVGRLWRHGAPLDWAGPWPTGSTTALPPIAWQHRPFWYDEPSVRSFLTEQHDPEGHT
VLGGRITVRGATPAHAWMTYLDRDSRPYPGDHPVRGVEILPAAVLLHTFLTAAETLVGAR
PELTDVALRVPVSVTAARYLQVVHQDGIVRLSSRIADGDESAWTTHTTAVVVAAPAVVDP
EPVLSVPTGGRLPTTYVVDRLAELGVAAMGFHWRVEQLRRDGRTLTALVDAGDPAGGWAP
VLDAALSIASVAFDGPPILRMPAHIGRVSLGPVAPQRVRVVVHRADDDTLTVEIAELGGV
VLGRLHRLRYGTLDQDSDAVTDPRNLLHEVAWTPAETHQGGHRPPARVLLVGPPSALRDR
VAAALRVAGVHWSTVSGPAELPSTVAGTVIVVPGPGVGGEPAAQAAWLLAQTAQRLAEAR
SDGTRLWCVTEGVRESVDPSALGHAALWGLGRIVAGEHPTLWGALVDVGTDPADLGTFVG
LLGGRPADPLVAVRDGRVTVPRLRPLTEPSTRPPLVCRPEATYLITGGLGALGLTVARWL
ADRGARRLVLAGRHTPPPRDTWHTLTDARDRAVVDAIDALERLGVTVVTAQVDVADPTAL
AELSSSAPLGLPPIRGVVHAAGVLDNRTLLELDEPSLRAVLRPKVDGALALHHRFPPGEL
DLFVLFSSCGGLLGLPGQASYAAGNAFLDALAAHRRAAGDVGTLSLAWTSWRGLGMSTSS
EVIDLELAARGTGDISAAEALGAWELAARQDREHAVVLRTLPPAPGTQRPALLSELTAPA
AAAPPTESEAWRELAGGTLREFLADTVRGEVVATTGLSAAEIDDRQPLTELGLDSVMTVR
IRRNLERRLAMSLPATIFWERPSVDAVTELLADLVGAVAEEAQ
NT seq 5172 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctggaaccgatcgccatcgtcggaatggcctgccgcttcgccggcgggatcgac
tccccggacgccttctgggagatgctctgcgacgggcgcgacgccgtcggcgacctgccc
gcgggccgctgggactggtacgcccagcagggccgggagcacgccacggccgtgcggtca
gcgaccagccggggcgcgttcctggacgacatcgcgggcttcgacgcggacttcttcggc
gtcaccccacgggaggccacgctgatggacccgcagcagcggatggtgctggagctggcc
tgggaggcgttggaacacgcggggattccgccgggacagctggccggcaccgacaccggc
gtctacgtcggcgtcggcgccgacgactacggccggcggatgctggaggacctgccccgg
atcgaggcgtggaccggcgtcggcggtggctactgcggcgtggccaaccgggtctcctat
ctgctggatctgcggggcccgagcatggtgctggacaccgcctgctcgtcgtcgcttgtc
gccgtgcacctggccgcgcaggcgctgcgcaacggggagtgcccggtggcgctcgccggc
ggggtcctggtgatcgccgcaccgggtctgtcgctggtgctcgacgccgccggcgccacc
gcccccgacggtcgcagcaaggcgttcgacgccgccgccgacgggtacggccggggcgag
ggcggcggggtcgtcgtactcaagcggttggccgacgcccggcgcgacggtgaccgggtg
ctggccgtgctccggggcagcgcggtgcaccaggacggccgcaccgacgggatcatggcc
ccgagcgcgcaggcccaggcccacctgctccgccgggcgtaccagaacgcgggggtggac
ccgtcgaccgtcggctacgtggaggcgcacggcaccgggacccgggccggcgacccgctg
gaggcgcaggcgatgtcggcggtgctcggggccggacgccccgccgaccgacccctgttg
atcggctcggccaagacgaacatcgggcacctggaggccggcgccggagtggccggactg
atcaaggcagtgctcacgctgcgacacggcgtcatcccgccgagcctgcacgtgcacacc
ccgaacccggccatcccgtgggacaccgccggcctgaaggtggtcaccgaactcaccccc
tgggtgcagaccgagggtccccggcgcgcgggcgtctgcggctacgggtacggcggcaca
atcgcccacgtcatcctggaggccgccgacgagcagccagccgccgacgagcaatcggcc
accgacgtgcccgacccggcgacaccgcagccggcgctgtaccccctctccggcgcgtcc
gccgccgccgtcggccagtacgccgcccgcctggccgaccggctcgaccgcccgcacccg
cccgccctcgccgacgtcgggtacaccctggcccgccgccgcgacgagctgccgtaccgg
gccaccgtggtcgccgcggaccgcaccgaactggtcgagcggctgcgcgcgctggccgcc
ccgagcggcgtcggcgagatcggccgcgcctccgcaccggccggtcggggcgtggtctgg
gtcttctccggtcacggctcacagtggatcgggatgggtcgcgagctgctgcacgccgaa
ccggtgttcgcggaggtgctcgacgaactcgaaccgatcttccaggcggagctggacgtc
tcgcccggcgcggcgttgcgggcgcagaccgcccacccggtcgacgtgatccagccgctg
atcttcgcggtccaggtggcgctcgccgcggtgctgcgcgcacacggcgcgcacccggcc
gcggtgctcggacactcggtgggtgagatcgccgcggcggtcaccgccggcctgctcacc
cgggaacagggggcccggctcgtctgccgacgctcggtgctgctgcgtcgggtggccggg
cagggcgcgatggcgatggtggacctgccacccgaggaggccgaacagcggctcaccgac
gacggcgacgtctgcgtggcgatcgccgcctcgccggtcgcgacggtgatctccggttcg
gcggcagcggtccgcgcggtcagtcgccggtgggccgacgagggcctcgacgtccggatg
gtcgactccgacgtggccttccacagctcgcagatggacgagctgaccgccgacctcgcc
gccgcctgcgccgacctgccgccggccgaggttccgaccgtcgcggtctactccacggcg
tcgaccgacagccgcaccgccgcaccgcgcgacggcgcgtactgggcggccaatctgcgc
gagcaggtgcgtctggcgcaggccgtcgaggccgccgcggccgacgggtaccgactgttc
ctggaggtgtccgcgcacccggtcgtgacgcactcgatcgccgagacgctcgacctgctc
ggcgtcgaggacaccctggtggcgcacacgctgcgccggcaccgcccggaacgggagagc
ctgctcggcgcggtgggccggctgtggcggcacggcgcaccgctggactgggcgggaccg
tggccgaccgggtcgacgaccgccctgccgccgatcgcctggcagcatcgcccgttctgg
tacgacgagccgtcggtgcggtccttcctgaccgagcagcacgaccccgagggccacacg
gtgctcggcggccggatcaccgtgcgaggggcgacaccggcgcacgcctggatgacctac
ctcgaccgggactcccggccgtacccgggcgaccacccggtccggggggtggagatcctg
ccggccgcggtgctgctgcacaccttcctgaccgccgccgagacgctggtgggggcgcgc
cccgagttgaccgacgtggccctgcgggtgccggtcagcgtgacggccgcccggtacctg
caggtggtgcatcaggacgggatcgtccgactgtcctcgcggatcgccgacggcgacgag
tccgcctggaccacccacacgacggcggtggtggtggcagcgccggccgtcgtcgacccc
gagccggtgctgtccgtaccgaccggcgggcggctgcccaccacgtacgtggtggaccgc
ctcgccgaactcggtgtcgccgcgatgggtttccactggcgggtcgagcagctgcgccgg
gacggccggacgcttaccgccctcgtggacgccggagatccggcgggaggctgggcaccg
gtcctcgacgccgcgctgtcgatcgcctcggtggccttcgacgggccgcccatcctgcgc
atgccggcgcacatcggccgggtcagcctcggcccggtcgccccgcagcgggtccgggtc
gtggtccatcgtgccgacgacgacacgttgaccgtcgagatcgccgaactcggcggggtg
gtcctcggccggctgcaccggttgcggtacggcaccctcgaccaggacagcgacgcggtc
accgatccccgcaacctgctgcacgaggtcgcctggacacctgcggaaacacaccagggc
gggcaccggccaccggcgcgggtgctgctggtcggcccgccgagcgccctgcgggaccgg
gtggccgcggcactgcgggtggccggggtgcactggagcacggtcagcgggccggcggag
ctgccgtccacagttgccggcacggtgatcgtcgtaccggggcccggtgtcggcggcgag
ccggccgcccaggcggcctggctgctcgcgcagaccgcgcagcgtctcgccgaggcccgg
tcggacggcacccgactctggtgcgtgaccgagggggtccgggagagtgtggacccgtcg
gcgctcggccacgccgccctgtgggggctgggccgcatcgtggccggcgagcatcccacc
ttgtggggtgcgcttgtcgacgtcggcaccgatccggccgacctcggcacgttcgtcggc
ctgctcggcggccggcccgccgacccgctcgtcgcggtcagggacggccgggtgacggtg
ccccggctccgcccgctcaccgaaccatcgacccgtcccccgctggtctgccgccccgag
gcgacatacctgatcaccggtgggctcggtgccctcggcctgacggtggcccgttggctg
gccgaccgtggcgcacgtcggctcgtgctggccggacgccacaccccgccgccccgggac
acctggcacacgctcaccgatgcgcgggatcgggccgtggtcgacgccatcgacgcgctg
gaacgactcggggtcaccgtggtgaccgcccaggtggacgtcgccgatccgacggcgctc
gcggaactgtcgtcttcggcaccgctcgggctgccgccgatccggggcgtcgtgcacgcc
gccggggtgctggacaaccgcaccctgctggaactcgacgagccctcgttgcgcgcggtg
ctgcgtcccaaggtcgacggggcgctggcgctgcaccaccggttcccgcccggcgaactg
gacctgttcgtgctcttctcctcctgcggcggactgctcgggctgcccggtcaggcgagt
tacgccgccggcaacgccttcctcgacgcgctcgcggcccaccgtcgcgcggccggtgac
gtcggcacgctcagcctggcctggacgtcgtggcgagggctcggcatgtccacctccagc
gaggtgatcgacctggagctggccgcgcgtggcaccggcgacatcagcgccgccgaggcc
ctcggcgcctgggagctggccgcccggcaggaccgggagcacgccgtggtgctgcgaacg
ctgccaccggcccccgggacgcagcggccggccctgctcagcgagctgaccgcgccggcc
gccgccgcgccgccgacggagagcgaggcctggcgcgagctggccggcgggacgctgcgg
gagttcctggccgacacggtacgcggcgaggtggtcgcgaccaccggcctgtccgcagcg
gagatcgacgaccggcagccgctgaccgaactcggcctggactcggtgatgaccgtccgg
atccgacggaacctggaacgccggctcgccatgtcgttgccggccaccatcttctgggag
cggccgagcgtggacgcggtgaccgaactgttggccgatctggtcggcgcggtggcggag
gaggcgcagtga

DBGET integrated database retrieval system