KEGG   Verrucosispora maris: VAB18032_27916Help
Entry
VAB18032_27916    CDS       T01471                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma00500  Starch and sucrose metabolism
vma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAB18032_27916
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VAB18032_27916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AEB46656
UniProt: F4F410
LinkDB All DBs
Position
5200506..5201954
Genome map
AA seq 482 aa AA seqDB search
MHRRRLRTAIVALGTITTLLAPTVVTAPPAVAAPTGGKKVIANLFEWNWPSVASECASTL
GPKGYGYVQVSPPQEHVRGNQWWVAYQPVSYRIESRKGTRDQFRSMVATCQAAGVKVIVD
AVINHMSGQTNGGTGWAGSSYQHHVYPGIYQAQDFNYCGRNGNNDIVNYNDRYEVQNCEL
VNLADLKTGSDYVRSRLAAYLNDLLSLGVDGFRLDASKHMPAADIANILSRLNRRPYIVQ
EVIYGAGEPIRPEEYTGNGDVHEFRYGKDLARVFRSERLAYLRNFGEGWGHLPSGVSSVF
IDNHDTQRDDGGVLTYRDRGIYALANAFMLAWPYGSPTVMSSYTYSSRDAGPPSDSSNKT
RNTVCYSGWECEHRWPVIANMVGFRNATEGTGVSNWYDNGYQHIAFSRTGKGFITINDED
FAVNSRSYYTGLPAGRYCDVIHGTFSAGTCSGPVITVDTNGWFTANVPAHDAIAIHLSAR
LP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgacgtcgactccgtacggcaatcgtggccctcggcacgatcaccaccctgctc
gcccccaccgtcgtgacggcacccccggccgtcgccgccccgaccggcggcaagaaggtc
atcgccaacctgttcgagtggaactggccctcggtggccagcgagtgcgccagcaccctc
ggcccgaagggctacggctacgtccaggtctcgcccccgcaggaacacgtccgcggcaac
cagtggtgggtggcgtaccagccggtcagctaccggatcgaatcccgcaagggcacccgc
gaccagttccggtccatggtcgccacctgccaggcggccggcgtcaaggtgatcgtcgac
gccgtcatcaaccacatgtccggtcagacgaacggcggcaccggctgggccgggtcgtcg
taccagcaccacgtctaccccggcatctaccaggcgcaggacttcaactactgcggccgt
aacggcaacaacgacatcgtcaactacaacgaccggtacgaggtgcagaactgcgagctg
gtcaacctggccgacctgaagaccggctcggactacgtccgctcgcggctggccgcgtac
ctcaacgacctgctgtcgctcggggtggacggcttccggttggacgccagcaaacacatg
cccgccgccgacatcgccaacatcctcagtcgactgaaccgccgcccgtacatcgtgcag
gaggtgatctacggtgccggcgagcccatccggcccgaggagtacaccggcaacggcgac
gtgcacgagttccgctacggcaaggacctcgcccgggtgttccgttccgagcggttggcg
tacctgcgcaacttcggtgagggctggggccacctgcccagcggggtctcctcggtcttc
atcgacaaccacgacacccaacgcgacgacggcggggtgctcacctaccgcgaccggggc
atctacgcgctggccaacgccttcatgctggcctggccgtacggctcgccgacggtgatg
tccagctacacctacagcagccgcgacgcgggcccaccctcggacagcagcaacaagacc
cgcaacacggtctgctactccggctgggagtgcgagcaccgctggccggtcatcgcgaac
atggtcggcttccgcaacgccaccgagggcaccggcgtcagcaactggtacgacaacggc
taccagcacatcgcgttcagccgtaccggcaagggtttcatcaccatcaacgacgaggac
ttcgccgtcaacagccgctcctactacaccggcctacccgccggccgctactgcgacgtc
atccacggcaccttctcggccggcacctgctccggcccggtcatcacggtcgacaccaac
ggctggttcaccgccaacgtccccgcccacgacgccatagccatccacctctccgcccgc
ctcccctaa

DBGET integrated database retrieval system