KEGG   Verrucosispora maris: VAB18032_27951Help
Entry
VAB18032_27951    CDS       T01471                                 

Definition
(GenBank) alpha amylase domain-containing protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma00500  Starch and sucrose metabolism
vma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAB18032_27951
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VAB18032_27951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AEB46663
UniProt: F4F417
LinkDB All DBs
Position
5208332..5210515
Genome map
AA seq 727 aa AA seqDB search
MRVPRPRAAIPAALAATLVAASLTVVATTTAPASAAEVRANGDAIVHLFQWRWDSIAEEC
ETNLGPNGWGGVQVSPPQEHVVLPSAEGATYPWWQDYQPVSYRLDATRRGSKAQFVDMVE
RCRAQGVKIYVDMVLNHMSGTGSANSGPGSAGTVYSKYSYPNLFNDGSGDSYGYADFGPC
YRKINNWGNKQEVQDCELLDLADLNTADPEVRRKIAKYMNAVIDLGVAGFRVDAAKHVQE
SHLADIINRLRDVPGFGGRPDLFHEVYGDGTIPYTAYAPYGGVTNFDYQRSVSSAFRDGN
IAQLGNLPNYGGLTGQQAVVFIDNHDTQRETPTLTYKNGARYYLADTFMMAHPYGRPQLM
SSYAFGSVHGQGPPSASNGTTLATDCTSSAWICEHRDAGVAGMPGFRNAVAGTGIASVVT
DGNGRLAFARGNRGYAAFNATGSTWSRSFSTSLPDGRYCNVGRGAYDRSTGACPGGAVTV
SGGSFSAAIPADQAVALHVEARLDGPTPTASPTVTPTASPTASPTPTASPTQPAGSTRFT
ATVTTNPGQEVYVVGSIPQLGSWNPANGVKLSTTSGSYPTWSGAVDVPAGTAFEWKLVKV
GNGVQWENDPNRTGTGGTAFTVTWNQPATNPPGEATVSFQATASTTYGQHIYVVGDLPAL
GGWDPAKGVRLSPTAYPVWTGQLSLPAGTAFSYKYVKRTDSGQVVWESGTNRTATASGSV
TLTDTWR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagttccccgtccccgcgccgcgatacccgcggccctggccgcgacacttgtcgcg
gccagcctcaccgtcgtcgccaccaccaccgccccggccagcgcagccgaggtacgcgcc
aacggcgacgcgatcgtccacctgttccagtggcggtgggactccatcgccgaggagtgc
gagacaaacctcggcccgaacggctggggcggggtgcaggtctcaccgccgcaggaacac
gtggtgctgcccagcgccgagggcgccacctacccgtggtggcaggactaccagccggtg
tcgtaccggttggacgccacccggcgcggctcgaaggcccagttcgtcgacatggtcgag
cgctgccgcgcgcagggcgtgaagatctacgtggacatggtgctcaaccacatgagcggc
accggctcggccaacagcggccccggcagcgccggcacggtctacagcaagtacagctac
ccgaacctgttcaacgacggttccggcgacagctacggctacgccgacttcgggccctgc
taccggaagatcaacaactggggcaacaagcaggaggtccaggactgcgagctgctcgac
ctggccgacctcaacaccgccgaccccgaggtacggcggaagatcgccaagtacatgaac
gcggtgatcgacctgggcgtggccgggttccgggtggacgcggccaagcacgtgcaggag
tcgcacctggccgacatcatcaaccggctgcgtgacgtgcccggcttcggcggccgaccg
gacctgttccacgaggtgtacggcgacggcacgatcccctacaccgcctacgcgccgtac
ggcggggtgaccaacttcgactaccagcggtcggtctcgtcggccttccgcgacggcaac
atcgcgcagctgggcaacctgcccaactacggtggcctgaccggacagcaggcggtggtg
ttcatcgacaaccacgacacccagcgggagactccgacgctcacctacaagaacggtgcc
cgctactacctggcggacacgttcatgatggcccacccgtacggccggccccagctgatg
tcgagctacgcgttcggctcggtgcacgggcagggcccgccgagtgcctccaacggcacc
accctggccacggactgcaccagcagcgcctggatctgcgagcaccgcgacgcgggggtg
gccggcatgccgggcttccgcaacgcggtcgccggcaccggcattgcctcggtggtcacc
gacggcaacggccggctcgcgttcgcccggggcaaccgggggtacgccgccttcaacgcc
accggcagcacgtggagccgcagcttcagcacctcactgccggacggccggtactgcaac
gtgggtcggggcgcgtacgaccggtcgaccggggcctgccccggcggggcggtgaccgtc
tccggtggcagcttcagcgccgccatcccggcggaccaggcggtcgccctgcacgtcgag
gcgcgcctggacggcccgaccccgacggccagtccgaccgtcacgcccaccgcttccccg
accgcttccccgacgccgacggcgagcccgacgcagccggccgggtcgacccggttcacc
gccaccgtcaccaccaaccccggccaggaggtgtacgtggtcggctcgatcccgcagctc
ggctcctggaacccggccaacggggtgaagctgtccaccacctcgggcagctacccgacc
tggagcggcgcggtcgacgtcccggccggtaccgccttcgagtggaagctggtcaaggtc
ggcaacggcgtgcagtgggagaacgaccccaaccgcaccggcaccggcgggacagccttc
acggtgacctggaaccagccggccaccaacccgcccggcgaggccacggtctccttccag
gccaccgcgagcaccacgtacggccagcacatctacgtcgtcggtgacctgcccgccctc
ggcggctgggacccggccaagggggtacgactctcgccgacggcgtacccggtgtggacc
gggcagctgagcctgccggcgggcaccgcattctcctacaagtacgtcaagcgcaccgat
tccggccaggtggtctgggagtcgggcaccaaccgcaccgccaccgcgtccggctcggtg
accctgaccgacacctggcgctga

DBGET integrated database retrieval system