KEGG   Verrucosispora maris: VAB18032_29961Help
Entry
VAB18032_29961    CDS       T01471                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
vma  Verrucosispora maris
Pathway
vma00020  Citrate cycle (TCA cycle)
vma00310  Lysine degradation
vma00380  Tryptophan metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
Module
vma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAB18032_29961 (kgd)
  09105 Amino acid metabolism
   00310 Lysine degradation
    VAB18032_29961 (kgd)
   00380 Tryptophan metabolism
    VAB18032_29961 (kgd)
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     VAB18032_29961 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh 2-oxoacid_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEB47063
UniProt: F4F8Y3
LinkDB All DBs
Position
5654293..5658063
Genome map
AA seq 1256 aa AA seqDB search
MSTQQTSQENPLAGFGPNEWVVEEMYQRYLADPSSVDPAWHDFFADYRPGPGAAKGDGEG
AGRSTSAAEPARKESAPAKAATATRTEPAKAEPAVKTEPAKTESRTAPAKTAPVKAQPRT
EPAKAPAKTAPAKTAPTATGPQTTPLRGVAAKIVQNMDASLAVPTATSVRAVPAKLLVDN
RIVINNHLARGRGGKVSFTHLVGYALVRALVAHPEMNNSYAQVDGKPTMVSPEHVNLGIA
IDLAKPDGSRNLVVPSIKGCEQMDFRQFWQAYEDVVRRARRNELTMDDYSGTTISLTNPG
GIGTVHSMPRLMQGQSAIIGVGAMEYPAPYQGMSEATLAELAVSKVITLTSTYDHRIIQG
AQSGEFLKVMHELLLGEHGFYDQIFTSLRIPYEPVRWMRDVAVDSEGQINKTARVHELIH
SYRVRGHLMADTDPLEFKIRKHPDLDVLQHGLTLWDLDRTFPVNGFAGKQRMKLRSILGV
LRDSYCRRVGIEYMHIQDPAERRWIQERVERKYEKPPADEQKHVLNRLNAAEAFETFLQT
KYVGQKRFSLEGGESLIPLLGEVLESAAEGGLDEVVIGMAHRGRLNVLANIVGKPYEKIF
SEFEGHLDPRSTQGSGDVKYHLGQSGKFTTPDGDHSVKVSVVANPSHLEAVDPVLEGIVR
AKQDRIDLKLEGYTVLPLAVHGDAAFAGQGVVAETLNLSQLRGYRTGGTVHVVVNNQVGF
TTAPEYSRSSLYSTDVARMIQAPIFHVNGDDPEAVVRVARLAFEYRQTFNKDVVIDMVCY
RRRGHNEGDDPSMSNPQMYKIIDSKRSVRKLYTEELIGRGDITVEDAEELLRDYQSQLER
VFKATRDAATTPRQLSRPPREDEPEPQVDTATDASVIKAIGEAHVNLPEGFTPHKRIQQL
LDRRAKMAVEGNIDWGFGEIIAFGSLLHDGVTVRLAGQDSRRGTFVQRHASIVDAETGDD
YLPLQSLTGDGERSRFFVHDSLLSEYAAMGFEYGYSVENLNALVCWEAQFGDFVNGAQSV
IDEFISSGEVKWGQRSAVTLLLPHGHEGQGPDHTSGRPERFLQLCAEDNMRVAIPTTPAN
YFHLLRRQALSPKRKPLVVFTPKSLLRHKLCVSSVNDFTTGTFAPVLADPAAPAPEQVKR
VLLCSGKVYYDLFQARQERGVTDTAIIRLEQLYPMPVEEIRAALAQYPNAEDFAWVQEEP
ANQGAWSFVALNLLEHLDGVRLRRISRPAAAAPAVGSAKMHEVEQVALLEAALPRP
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacccagcagacttcgcaggagaacccactggcgggtttcggcccgaacgagtgg
gtcgtcgaggagatgtatcagcgctacctcgccgaccccagcagcgtcgacccggcctgg
cacgacttcttcgccgactaccggcccgggccgggtgcggccaagggcgacggtgagggc
gccggccggtcgacgagcgccgccgagcctgcccgcaaggagtcggccccggccaaggcc
gcgaccgccaccaggaccgagcccgccaaggccgagccggccgtcaagaccgagcccgcc
aagaccgagtcgcgtaccgcgccggcgaagactgcgccggtcaaggcccagccccggacc
gagccggcgaaggcgccggccaagaccgccccggcgaagaccgcgccgaccgccaccggt
ccgcagaccaccccgttgcgcggcgtggccgccaagatcgtccagaacatggacgcctcg
ctggccgtgccgaccgcgaccagcgtgcgcgccgtcccggcgaagctgctggtggacaac
cggatcgtgatcaacaaccacctggcccggggccgcggtggcaaggtcagcttcacccac
ctggtcgggtacgccctggtccgggcgctggtcgcgcacccggagatgaacaactcctac
gcccaggtcgacggcaagccgacgatggtcagcccggagcacgtcaacctgggcatcgcc
atcgacctggccaagccggacggcagccgcaacctggtggtcccctccatcaagggctgc
gagcagatggacttccggcagttctggcaggcgtacgaggacgtggtccggcgcgcccgc
cgcaacgagctgaccatggacgactactccggcaccacgatctcgctgaccaacccgggc
ggcatcggcaccgtgcactcgatgccgcgcctgatgcagggccagagcgcgatcatcggg
gtcggcgcgatggagtacccggcgccgtaccagggcatgagcgaggccaccctggccgag
ctggcggtcagcaaggtcatcacgctgaccagcacgtacgaccaccggatcatccagggc
gcgcagtccggcgagttcctcaaggtcatgcacgagctgctcctcggcgagcacggcttc
tacgaccagatcttcacctcgctgcgcatcccgtacgagccggtgcgctggatgcgcgac
gtcgcggtcgacagcgaaggccagatcaacaagaccgcccgggtgcacgagctgatccac
tcctaccgggtccgcggtcacctgatggccgacaccgatccgctggagttcaagatccgc
aagcacccggatctggacgtgctccagcacgggctgaccctgtgggacctggaccgcacc
ttcccggtcaacggcttcgctggcaagcagcggatgaagctgcgctcgatcctgggcgtg
ctgcgggactcgtactgccggcgggtcggcatcgagtacatgcacatccaggacccggcc
gagcgtcgctggatccaggagcgggtcgagcgcaagtacgagaagccgccggccgacgag
cagaagcacgtactcaaccggctcaacgcggccgaggccttcgagaccttcctgcagacc
aagtacgtcggccagaagcgcttctcgctggagggcggcgagtcgctgatcccgctgctc
ggcgaggtcctggagtccgccgccgagggtggcctggacgaggtcgtcatcggcatggcc
caccggggccggctcaacgtgctggccaacatcgtcggcaagccgtacgagaagatcttc
tcggagttcgaggggcacctggacccacgctccacgcagggctccggcgacgtgaagtac
cacctcggccagagcggcaagttcaccacccccgacggcgaccactcggtcaaggtctcc
gtggtggcgaacccgtcgcacctggaggcggtcgacccggtgctggagggcatagtccgg
gccaagcaggaccgcatcgacctcaagctggagggctacaccgtgctgccgctggcggtg
cacggtgacgccgccttcgccggtcagggtgtggtggccgagacgctcaacctctcccag
ctgcgcggctaccgcaccggcggaacggtccacgtggtggtcaacaaccaggtgggcttc
accaccgcgccggagtacagccgctccagcctctacagcaccgacgtggcccggatgatc
caggcgccgatcttccacgtcaacggcgacgaccccgaggccgtggtccgggtcgcccga
ctggccttcgagtaccggcagacgttcaacaaggacgtcgtgatcgacatggtctgctac
cggcggcgcgggcacaacgagggcgacgacccctcgatgtccaacccccagatgtacaag
atcattgattcgaagcgctcggtccgcaagctctacaccgaggagctgatcggccgcggc
gacatcaccgtggaagacgcggaggagctgctgcgcgactaccagtcccagctggagcgg
gtcttcaaggccacccgtgacgcggccaccaccccgcgccagctcagccggccgccccgc
gaggacgagccggagccgcaggtcgacacggccaccgacgcgtcggtgataaaggccatc
ggtgaggcgcacgtcaacctgcccgaaggcttcacgccgcacaagcggatccagcagctg
ctcgaccggcgggccaagatggccgtcgagggcaacatcgactggggtttcggcgagatc
atcgccttcggttccctgctgcacgacggggtcaccgtccgactggccgggcaggactcg
cgtcgcggcaccttcgtgcagcggcacgcctccatcgtcgacgccgagaccggcgacgac
tacctgccgttgcagtcgctcaccggtgacggcgagcggtcccggttcttcgtgcacgac
tcgctgctgtccgagtacgccgcgatgggcttcgagtacggctactcggtggagaacctc
aacgccctggtctgctgggaggcgcagttcggcgacttcgtcaacggcgcccagtcggtg
atcgacgagttcatctcctccggtgaggtgaagtggggtcaacgctccgcggtgaccctg
ctgctgccgcacggccacgaggggcagggtccggaccacacctccggccgcccggagcgg
ttcctccagctctgcgccgaggacaacatgcgggtggccatcccgaccaccccggcgaac
tacttccacctgctgcgccgtcaggcgctgtcgcccaagcgcaagccgcttgtggtgttc
acgccgaagtcgctgctgcggcacaagctctgcgtctcctcggtgaacgacttcaccacc
ggcaccttcgccccggtgctggccgacccggccgctccggcgccggagcaggtcaagcgg
gtgctgctctgctcgggcaaggtctactacgacctgttccaggcccggcaggagcgcggc
gtcaccgacaccgcgatcatccggctggagcagctctacccgatgccggtggaggagatc
cgggcggctctcgcccagtacccgaacgccgaggacttcgcctgggtgcaggaggagccg
gccaaccagggtgcctggtcgttcgtggcgctcaacctgctggagcacctcgacggcgta
cggctgcgccgcatctcccgccccgccgccgccgccccggctgtcggctcggcgaagatg
cacgaggtcgagcaggtcgcgctcctcgaagcggcacttccccgaccctga

DBGET integrated database retrieval system