KEGG   Verrucosispora maris: VAB18032_30011Help
Entry
VAB18032_30011    CDS       T01471                                 

Definition
(GenBank) putative nickel-containing superoxide dismutase precursor
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
vma  Verrucosispora maris
Brite
KEGG Orthology (KO) [BR:vma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VAB18032_30011
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VAB18032_30011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AEB47073
UniProt: F4F8Z3
LinkDB All DBs
Position
5667025..5667429
Genome map
AA seq 134 aa AA seqDB search
MRLARILAPRLTASAHCDLPCGVYDPAQARIEAESVKMICEKYQANTDPEFRTRAILIKE
QRADLVKHHLWVLWTDYFKPPHFEKYPHLHQLFNEATKLAGAAGAKGATDPAKADELLQK
IDEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttgcccgcatcctcgcgcctcgcttgaccgccagcgcgcactgcgacctgccc
tgcggtgtctatgaccccgcccaggctcggatcgaggccgagtcggtgaaaatgatctgc
gagaagtaccaggccaacaccgacccggagtttcggacccgcgccatcctgatcaaggag
cagcgggctgacctggtcaagcaccacctctgggtgctgtggaccgactacttcaagccg
ccgcacttcgagaagtacccccacctgcaccagctgttcaacgaggccaccaagctggcc
ggggccgccggtgccaagggtgccaccgacccggccaaggccgacgaactgctccagaag
atcgacgagatctccaagatcttctgggagaccaagcaggcctga

DBGET integrated database retrieval system