KEGG   Vibrio mimicus: AL543_07085
Entry
AL543_07085       CDS       T04381                                 

Definition
(GenBank) sensor domain-containing diguanylate cyclase
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vmi  Vibrio mimicus
Pathway
vmi05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    AL543_07085
Enzymes [BR:vmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AL543_07085
SSDB
Motif
Pfam: GGDEF HAMP
Other DBs
NCBI-ProteinID: AMG02825
LinkDB
Position
2:complement(242535..243827)
AA seq 430 aa
MIERVTTSPLVNRLLKMISLCALVYLLIILAIIIPRGLHLVGEQKQELEQKLALSLSNSA
SIALYVNNYDIASEVMDALLLHKEINAVKLVGVDGVVFERTSVVQTAKDHNFWEDASQYH
LTSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVMIQFLVTFVALIWIVRRLVGKPL
TELSEALSEVRPDHDRKVTVAIENKYNEIGLVAESINEFIDASHQALIRERELRQQIERW
ENYYRIIAEQDTLSGLKNRLGCEKYVLNKKRSSSIMVLLLIDLDGFKQVNDTLGHAAGDD
VLREIAKRFLSLAQARFSDSVVGRLGGDEFAIYIPLDSFDPSAIEEFAMQLIQASSTPIL
LGKQSTQVGCSIGISYMDCLHIDLEKLLLQADKAMYWVKHRGKLNYHIYSAGQEVRPLPS
NPEVKRDQSK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgattgagcgcgtaacgacttctcctctagtaaaccgtctactaaagatgatttcattg
tgtgcactggtctatttgctgattattttggccattattattccgcgtggcctgcactta
gttggggagcagaaacaagaactggaacagaagttagcgctctccttgagtaattccgct
tcaattgccttgtatgtgaataactatgatattgcctcagaggtgatggatgccttgctg
ctgcataaagaaattaatgcggttaagttggtgggggtcgatggcgtcgtatttgaacga
acaagcgtggtacaaaccgccaaagatcataatttctgggaagatgcgagccaataccac
ttaacatcacctgttgatgggaatctgattggttacttaatgattcatgaggatcaccaa
gtgatccgtcagcaagcgatcaatcaaatcctggatcaaattgccgtagtgatgattcaa
tttcttgtgacttttgttgcgttgatttggattgttcgtcgcctagtgggtaagccatta
acagagctttctgaagcgctgtctgaagtgcgaccagatcatgatcgtaaggtcactgtc
gcaatcgagaacaaatacaatgagattggtctcgtggcggaaagcatcaatgaattcatt
gatgcctctcatcaagcattgattcgagagcgtgaattacgccaacagattgaacgttgg
gaaaattactatcgcatcattgctgagcaggacacgttgagtggacttaaaaatcgcttg
ggttgcgagaaatatgtactgaataaaaagcgctccagttcaatcatggtgttgctgttg
atcgatttggacggcttcaagcaagtgaatgataccttggggcatgcggcgggtgatgat
gtactgcgggaaatcgccaaacgttttttgtctctggctcaagcccgcttttccgattca
gttgtcgggagactcggtggagatgagtttgccatctacattccgctcgactcttttgac
cccagcgcgatagaagagtttgcgatgcaattgatacaagcttcttctactcccatcctc
ttgggtaagcagagtacgcaagtagggtgcagtattggtattagctatatggattgctta
cacatcgatttagaaaagctgctgttgcaagccgataaagccatgtattgggttaaacac
agaggtaagctcaactaccatatttacagtgctgggcaggaagtacgtccgctgcccagc
aatccagaggttaaacgagatcaatccaaataa

DBGET integrated database retrieval system