KEGG   Vibrio mimicus: AL543_14350Help
Entry
AL543_14350       CDS       T04381                                 

Gene name
fadI
Definition
(GenBank) acetyl-CoA C-acyltransferase FadI
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
vmi  Vibrio mimicus
Pathway
vmi00071  Fatty acid degradation
vmi00280  Valine, leucine and isoleucine degradation
vmi00281  Geraniol degradation
vmi00362  Benzoate degradation
vmi00592  alpha-Linolenic acid metabolism
vmi01100  Metabolic pathways
vmi01110  Biosynthesis of secondary metabolites
vmi01120  Microbial metabolism in diverse environments
vmi01130  Biosynthesis of antibiotics
vmi01212  Fatty acid metabolism
Module
vmi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL543_14350 (fadI)
   00592 alpha-Linolenic acid metabolism
    AL543_14350 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL543_14350 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AL543_14350 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL543_14350 (fadI)
   00642 Ethylbenzene degradation
    AL543_14350 (fadI)
Enzymes [BR:vmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AL543_14350 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMG04089
LinkDB All DBs
Position
2:1737706..1739013
Genome map
AA seq 435 aa AA seqDB search
MGKQEVRTRSGERVAIVAGLRTPFARQSTEFGQVPAVDLGKMVVQEMMARTAIDPKLIEQ
VVFGQVVQMPEAPNIAREIVLGTGMSIHTDAYSVTRACATSFQAAVNVAESIMAGTIDIG
IAGGADSSSVLPIGVSKKLAASLLALSKAKAMGQKLKLLSNLSFKDLIPVPPAVAEYSTG
LSMGQTAEQMAKSYAISRADQDALAHRSHTLAAQAWAEGKIRDEVMTAFPEPYKKWIDTD
NNIRLDSKLESYAKLRPAFDRQYGSVTAANSTPLTDGAAAIMLMREGKAKELGLEIMGYI
RSYAFAAIGVEKDMLMGPSYATPIALDRAGITLNDLTLIDMHEAFAAQTLANLKMFASDK
FAQEQLGRAQAIGEVDMSKFNVLGGSLAYGHPFAATGARMITQTLRELKRRGGGLALNTA
CAAGGLGAAMILEVE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcaggaagtcaggactcgttctggagaacgagtggcgatagtggcggggcta
cgtacgcctttcgcccgtcaaagtaccgaatttggtcaagtacccgcagttgatctcggc
aaaatggtggtgcaagaaatgatggcgcgcacagctattgatccgaaattgattgaacaa
gttgtgtttggtcaagtggttcaaatgccagaagcccccaatattgctcgagaaattgtg
ttgggtacgggaatgtcgattcatacggatgcttacagcgtaacccgtgcctgcgcgacc
agttttcaagcggcggtcaatgttgcagaaagcattatggctggaacgattgatatcggt
attgcaggtggtgcggattcctcttctgttctgcccattggtgtttccaaaaaactggct
gcttctttattagcactgagcaaagccaaagcgatgggccaaaagctcaagctgctcagc
aacctctctttcaaagatttgattcctgttcctcctgcagtggctgaatattctactggg
ctttccatggggcaaacggctgagcagatggccaaaagctatgccatttctcgcgccgat
caagatgcgttagcgcatcgttcacatactttagcggctcaggcatgggcagaagggaaa
attcgcgatgaagtgatgaccgctttcccagagccttataaaaagtggattgataccgac
aataacattcgccttgattccaaattagagagttatgcaaagttgcgtccggcgtttgat
cgtcaatacggttcagtgactgcagcaaattcaacgccgctaaccgatggtgcagccgcg
attatgttgatgcgcgaaggcaaagccaaagaacttggtctggagatcatgggttacatc
cgttcttatgcgtttgcggcgattggcgtggaaaaagatatgttgatggggccatcgtac
gcaacgccgattgcattggatcgcgcaggtataactctaaacgatttgaccttgattgat
atgcacgaagcctttgcggcgcaaaccttggcgaacttgaagatgttcgcgagcgataag
ttcgctcaagagcaactcggtcgtgcgcaagccatcggcgaagtcgatatgagcaaattt
aacgtccttggcggttcattggcgtatggtcatccattcgcagccacgggcgcgcgaatg
atcactcaaacattacgtgaattgaaacgccgcggtggaggcttagccttaaatacagct
tgtgctgctggtggtttgggcgctgcaatgattttggaggtggaataa

DBGET integrated database retrieval system