KEGG   Vibrio mimicus: AL543_19155Help
Entry
AL543_19155       CDS       T04381                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vmi  Vibrio mimicus
Pathway
vmi00220  Arginine biosynthesis
vmi00250  Alanine, aspartate and glutamate metabolism
vmi00290  Valine, leucine and isoleucine biosynthesis
vmi01100  Metabolic pathways
vmi01110  Biosynthesis of secondary metabolites
vmi01130  Biosynthesis of antibiotics
vmi01210  2-Oxocarboxylic acid metabolism
vmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL543_19155
   00290 Valine, leucine and isoleucine biosynthesis
    AL543_19155
   00220 Arginine biosynthesis
    AL543_19155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vmi01007]
    AL543_19155
Enzymes [BR:vmi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AL543_19155
    2.6.1.66  valine---pyruvate transaminase
     AL543_19155
Amino acid related enzymes [BR:vmi01007]
 Aminotransferase (transaminase)
  Class I
   AL543_19155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AMG04960
LinkDB All DBs
Position
2:2818760..2819974
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIVEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtacttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacctacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggagcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctgcccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgacgaagaagccgattggtatcctgacctcgatgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcgtcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgccgtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctacattgcagggctcgatatgctggcctcgatgcgcttgtgtgccaacgtg
ccaatgcaacacgccattcaaaccgcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggccgattgctggagcagcgtgatcgcgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccgaaaggcgcgatgtacctgttcccgaaaattgatacc
aagatgtatccgatcaaagatgaccagaaaatggtgctcgatttcctagtgcaagaaaaa
gtgctgctggtacaaggcagtggttttaactggccaaaaccggatcacttccggattgtg
actctgccacatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacc
acttacagccaataa

DBGET integrated database retrieval system