KEGG   Vulcanisaeta moutnovskia: VMUT_0096Help
Entry
VMUT_0096         CDS       T01440                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vmo  Vulcanisaeta moutnovskia
Pathway
vmo03030  DNA replication
vmo03410  Base excision repair
vmo03420  Nucleotide excision repair
vmo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vmo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VMUT_0096
   03410 Base excision repair
    VMUT_0096
   03420 Nucleotide excision repair
    VMUT_0096
   03430 Mismatch repair
    VMUT_0096
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vmo03032]
    VMUT_0096
   03400 DNA repair and recombination proteins [BR:vmo03400]
    VMUT_0096
Enzymes [BR:vmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VMUT_0096
    6.5.1.6  DNA ligase (ATP or NAD+)
     VMUT_0096
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VMUT_0096
DNA replication proteins [BR:vmo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VMUT_0096
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VMUT_0096
DNA repair and recombination proteins [BR:vmo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VMUT_0096
   NER (nucleotide excision repair)
    Other NER factors
     VMUT_0096
   MMR (mismatch exicision repair)
    Other MMR factors
     VMUT_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ADY00312
UniProt: F0QSG1
LinkDB All DBs
Position
98162..99982
Genome map
AA seq 606 aa AA seqDB search
MSSGNDIKFIDVVRVLESIEATTQRTVMAKLLSSLLKKTPPDVIDKVIYFILGQLRPDWE
GVELGVAEKFTFRAIANATGASVKQVEDLYKKIGDIGETAKRIMSSKPQQGGGKSILEFF
GGGGIEELTMGKVYDTLMSIAKASGEGAQDTKVKLLIYLFSRAKPEEAKYIARFVIGRLR
LGVADMTILDALSDAYKVSRDALERAYHIYPDLGYIAKMVAQEGQNALSKIHVTPGVPIQ
PMLAERLSTAAEILAKLGGTAMVEYKYDGERAQVHRTRDGEVRIFSRRLENITYAYPDVA
EYVKEAIDAKEYIVEGEIIAIDPDTGEFRPFQELMHRKRKHDVKEAMKEYPVNIFLFDVM
YVDGQDLTNLPLIDRKRRLLEILKPSEYVHLATWRVINDAEELDKFFHEAISDGCEGVMC
KSIKADSIYEMGARGWLWIKYKRDYRSELTDTLDLVVVGAFWGRGKRAGTYGALLIAAYD
PKTDQFYTVSKVGSGFTDEDLVKLKQMLDPYRIPHRHPRVVSKMEPDVWFVPAVVLEIIG
AEITLSPLHTCCVGSVRSDVGLAIRFPRFTGRYRTDKSPEQATTVDEILEMYKEQKKVKV
EEGPNP
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcggtaatgatattaaattcatcgatgttgtgagagttcttgagagtattgag
gcaactactcaaaggactgtcatggccaagttactatcatctctcctaaagaagacgcca
ccggatgttattgataaggttatttacttcatacttggtcagttaaggcctgattgggag
ggtgtggagcttggtgtcgctgaaaagttcacctttagggctattgccaatgccactggg
gcctctgttaagcaagtcgaagatttatataaaaagattggcgatattggcgaaaccgcg
aagaggataatgagtagtaaacctcagcagggtggcggtaagtcaatacttgagttcttt
ggtggtgggggtattgaggaattgacaatgggtaaggtctacgatacgttaatgtcaata
gccaaggcaagcggtgagggtgcccaagatactaaggttaagctcctaatatacctattc
tcaagggctaagcctgaggaggctaagtacattgctaggttcgtgattggtaggttaagg
cttggtgttgctgacatgaccatactggatgccctgtctgatgcttataaggtgtctagg
gacgcccttgagagagcctaccacatttacccagaccttggttatatagcaaagatggtt
gcccaggagggtcagaacgccttaagtaagatccatgtgacgccgggtgtacccatccag
ccaatgcttgcggaaagattgagtacagcagctgagatactggctaagctaggtggtact
gcaatggttgagtataagtatgatggcgaaagggctcaggtgcataggactagggatggc
gaggttaggatcttcagtaggagacttgagaacatcacgtatgcttatccagacgttgct
gagtatgttaaggaggccattgatgccaaggagtacatagtggagggtgagataatagct
attgatccggacacgggtgagtttaggcccttccaggagttaatgcataggaagaggaag
catgatgtcaaggaggcgatgaaggagtacccagtcaacatattcctgtttgatgttatg
tatgtcgatggacaggacctaacgaatttaccactgattgataggaagagaaggctgctc
gaaattctcaaaccaagtgagtatgtccatctagcgacttggagggtaattaatgatgct
gaggaacttgataagttcttccatgaggccataagtgatggttgtgagggagtcatgtgt
aagtccattaaagctgactccatttatgaaatgggcgccaggggctggctctggattaag
tataagcgtgactataggagtgaattgacggataccctggacttagtcgttgttggcgcc
ttctggggccgtggtaagagagctggcacgtatggtgcattgcttattgctgcctatgac
cctaagactgaccaattctacacagtgagtaaggtgggtagtggatttaccgatgaggac
ttagtaaagcttaagcagatgcttgacccgtataggataccgcataggcatccaagggtt
gtctctaagatggagcctgatgtttggtttgtacctgccgtcgtccttgaaataatcggc
gctgaaataaccttaagtccactccacacttgttgcgtgggtagcgtaagatccgatgtt
ggactggccattagattcccaagattcacgggacgctatagaaccgataaatcaccagaa
caagcaacaacagtggatgaaatcctcgagatgtataaggagcagaagaaggtcaaggtt
gaggaaggccctaacccatga

DBGET integrated database retrieval system