KEGG   Vulcanisaeta moutnovskia: VMUT_0233Help
Entry
VMUT_0233         CDS       T01440                                 

Definition
(GenBank) NUDIX hydrolase
Organism
vmo  Vulcanisaeta moutnovskia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ADY00448
UniProt: F0QTA6
LinkDB All DBs
Position
224535..224999
Genome map
AA seq 154 aa AA seqDB search
MSREYPRYPLVGVGSIVIKDGKILLIRRGAEPNRGKWSIPGGMVEPGEDPDYAALRELRE
ETGIIGKVIGLFGIYQYLERDSEGRIKYHFLLLDYLVEPIGGTPKASSDAIELRFIGLRE
ALNLDLTDTAKQLLMDLLASGPRPCGGGLIKLTH
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcagggaatatccacgatatccgctggttggtgttggctctatagttattaaggac
ggaaagattttactgataaggagaggtgcagaacctaatagaggtaagtggtcaatacct
ggcggtatggtcgagcccggcgaagatcctgattacgctgccttaagggaactaagggag
gaaaccggcattattggtaaggtaattggactctttggtatttatcaatatttagaacgt
gattctgaaggtaggattaagtaccactttctacttcttgattacttggtcgaaccaata
ggcggaacacctaaggcatccagtgatgctatagaattaaggtttattggattaagggaa
gcattgaatttggatctaacggacacagcaaagcagttattaatggatttattggcttct
ggaccaagaccatgtggtggtggcttaattaagctcactcattag

DBGET integrated database retrieval system