KEGG   Vibrio natriegens: PN96_06015Help
Entry
PN96_06015        CDS       T04636                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vna  Vibrio natriegens
Pathway
vna03030  DNA replication
vna03410  Base excision repair
vna03420  Nucleotide excision repair
vna03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vna00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PN96_06015
   03410 Base excision repair
    PN96_06015
   03420 Nucleotide excision repair
    PN96_06015
   03430 Mismatch repair
    PN96_06015
Enzymes [BR:vna01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PN96_06015
    6.5.1.6  DNA ligase (ATP or NAD+)
     PN96_06015
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PN96_06015
DNA replication proteins [BR:vna03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PN96_06015
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PN96_06015
DNA repair and recombination proteins [BR:vna03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PN96_06015
   NER (nucleotide excision repair)
    Other NER factors
     PN96_06015
   MMR (mismatch exicision repair)
    Other MMR factors
     PN96_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase ParA
Motif
Other DBs
NCBI-ProteinID: ALR17218
LinkDB All DBs
Position
1:complement(1306112..1306948)
Genome map
AA seq 278 aa AA seqDB search
MKMTLIALAIMASTHVQAHPTVAPLVSLAETYQDGIDVSQYWYSEKLDGIRAYWTGQHLV
TRNGNRIHAPKWFTAPLPDYPLDGELWAGRGNFHLVQQTVLDKTPVDSAWKKVDFMLFDM
PYSAGDYRKRYYNIQNLVYELDEPHIKYVEHMAIQDEEHLFSQLDKIALADGEGVMLRKV
SSRYQAGRGSDLLKLKRFADTEAQVIGHKPGTGRLLGMMGAILVRMPDGTEFYIGSGFTD
ELRRNPPQLGSIITFRYNGFTHNGKPKFARFLRERSKE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ataaaaatgacattgatcgcactcgccattatggcatccacgcacgttcaagcccatcca
actgtcgcgcctttagtctcgctagcagaaacctatcaagatgggattgatgtgtcgcaa
tactggtacagtgaaaaactggatggtattcgtgcttactggacggggcaacaccttgta
acacgtaatggaaaccggatacacgctcctaagtggtttacagcaccattgccagattac
cctctggatggggaactttgggccgggcgaggtaattttcatttggtccagcaaacggtt
ttggacaaaacaccggtcgacagcgcgtggaagaaagtagattttatgttgtttgatatg
ccttactctgcgggtgactatcggaagcgctattacaatatccaaaacttggtgtatgaa
ctggacgagccacacattaagtacgtcgagcatatggctattcaagatgaagagcactta
tttagccaattagacaaaatcgcgttagctgatggggaaggtgtcatgttacgcaaggtg
tctagtcgttaccaagcgggccggggcagtgatttacttaagttaaaacgttttgccgat
acagaagcacaagtgatcggacataagcccggtactggtcgcttgctgggaatgatgggc
gcgattctggttcgtatgcctgatggtacagagttttatattggtagtggatttacagac
gagttgcgtcgaaacccaccacaattgggttcgattatcacatttaggtacaacgggttt
actcataacggaaaaccgaaatttgcccgatttttgcgcgagcgttctaaagagtag

DBGET integrated database retrieval system