KEGG   Vibrio natriegens: PN96_09285Help
Entry
PN96_09285        CDS       T04636                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vna  Vibrio natriegens
Pathway
vna00020  Citrate cycle (TCA cycle)
vna00190  Oxidative phosphorylation
vna00650  Butanoate metabolism
vna01100  Metabolic pathways
vna01110  Biosynthesis of secondary metabolites
vna01120  Microbial metabolism in diverse environments
vna01130  Biosynthesis of antibiotics
vna01200  Carbon metabolism
Module
vna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vna_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PN96_09285 (sdhB)
   00650 Butanoate metabolism
    PN96_09285 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PN96_09285 (sdhB)
Enzymes [BR:vna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PN96_09285 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PN96_09285 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ALR16165
LinkDB All DBs
Position
1:complement(2043844..2044554)
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDTKPYMKDYTLDVEEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
DDGALPPSRENLQSPDDRAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacttctctttgtaccgttacaacccggatgtagacactaagccttacatg
aaagactacacacttgatgtagaagaaggctcagacatgatggttctggatgcgttgatt
ctgcttaaagagcaagatccaagcatcgcattccgtcgttcatgccgtgaaggtgtttgt
ggctctgacggcctgaacatgaacggtaaaaacggcttggcatgtatcacaccattgtct
gcactacaaggtgacaagatcgtaattcgtccactaccaggtctacctgtggtacgtgat
cttattgttgacatgacgcagttctatgataactatgcgaaagttaagccattcttgatc
gatgatggtgcattaccaccttctcgtgagaatctgcagtcaccagatgaccgtgctcat
ttagatggtttgtacgaatgtatcatgtgtgcatgttgtacaacttcttgtccgtcattc
tggtggaacccggacaaattcatcggtcctgcaggtcttctagcggcttaccgttggtta
attgatagccgcgatacggcaacagatgaacgtttgtctgatcttgatgacgcatttagc
gtttttcgttgccatggcatcatgaattgtgtaagtgtttgtccgaaaggacttaacccg
acgaaagcaatcggccatatcaagtcgatgctggtaaatcgctcggtgtaa

DBGET integrated database retrieval system