KEGG   Vibrio natriegens: PN96_15195Help
Entry
PN96_15195        CDS       T04636                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
vna  Vibrio natriegens
Pathway
vna02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PN96_15195 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vna02000]
    PN96_15195 (pstB)
Enzymes [BR:vna01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     PN96_15195 (pstB)
Transporters [BR:vna02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    PN96_15195 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 RsgA_GTPase AAA_16 AAA_23 AAA_29 Rad17 AAA_18 AAA_30 AAA_5 Adeno_IVa2 AAA AAA_25 AAA_33 AAA_28 DeoRC NACHT AAA_14 AAA_24 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ALR17344
LinkDB All DBs
Position
2:complement(49878..50627)
Genome map
AA seq 249 aa AA seqDB search
MNKFDIENLDLFYGENQALKSINLPIPVRQVTALIGPSGCGKSTLLRCLNRMNDLIEGVT
ITGKLAMDGEDIYGNIDVADLRIKVGMVFQKPNPFPMSIYENVAYGLRAQGVKDKKYIDE
VVERSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTIAMEPDVILMDEPTSALDPIA
THKIEELMEELKKNYTIVIVTHSMQQARRISDRTAFFLMGELVEHNDTQVIFSSPQDDRT
QGYVNGDFG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtttgatattgaaaacctagaccttttttacggtgaaaaccaagcactgaaa
tcaatcaacctgcctattccagttcgtcaggtaacggcactaatcggcccgtcaggttgt
ggtaagtcaacacttctgcgttgtttgaaccgtatgaacgacctgattgaaggcgtaacc
attactggtaagctggcgatggatggtgaagacatctacggcaatattgatgtcgcggat
cttcgtattaaagtcggtatggtattccagaagccaaacccattcccaatgagcatttac
gagaatgtggcttatggcttacgtgctcaaggtgttaaagacaaaaagtacattgatgaa
gtggttgagcgttcactacgtggcgcagcactttgggatgaagtgaaagatcgtcttaag
tcacacgcttttggtctttctggtggtcagcagcagcgtctgtgtattgcacgcacaatc
gctatggaacctgatgtgatccttatggacgagccaacgtcggcgcttgacccaattgca
acgcacaaaatcgaagaattgatggaagagctgaagaagaactacaccatcgttatcgtg
actcactcaatgcaacaggcgcgtcgtatttctgaccgcactgcgttcttcctgatggga
gaactggttgagcacaacgatacgcaagtgatcttcagtagcccacaagatgaccgaact
caaggttacgtaaacggtgacttcggttaa

DBGET integrated database retrieval system