KEGG   Vibrio natriegens: PN96_16140Help
Entry
PN96_16140        CDS       T04636                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vna  Vibrio natriegens
Brite
KEGG Orthology (KO) [BR:vna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PN96_16140
Enzymes [BR:vna01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PN96_16140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 DAO Chalcone_N Thi4 Thioredoxin_9 NAD_binding_8 Thioredoxin_4 DUF5474
Motif
Other DBs
NCBI-ProteinID: ALR17520
LinkDB All DBs
Position
2:285481..287049
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKAANDILSLANQIAEMSEHISVVRDDAASD
RKPVMAVTNPTKGTALSFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDRELD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGALFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDSASEKAAKALDEKEPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFVSVKRTEGPKLAADLGEHLKEYDVDVVTEQQAKKLMGAAHTE
DGLIHIQLESGATLKSQSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKELELSGIFVQIGLVPNTEWLKDSDVNLSPRGEIEVGSHGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagac
gtacgtctagtggttagcctagatgaaagcaaagcggcaaatgatattttgtctctcgct
aatcaaatcgcagaaatgagcgagcatatttctgttgttcgtgacgacgcagccagtgac
cgtaaaccagtaatggcggtaaccaacccgactaaaggaacagcacttagctttgctggc
ctgcctatgggccatgaatttacgtcactagtccttgctctgcttcactctggcggtcac
ccaatcaagctagagccagaagtgattgaacaaatcgctgcgctagatagagaactggat
gtagaaatctttatttctctgtcttgtcagaactgtcctgatgttgttcaggcgtttaac
atgatggcagcgattaacccgaaagtgaaagcaaccatgatcgacggtgctttgttccaa
gacgaagtgaaacagcgcgatatcatggcagtaccaagtgtattcgttaacggtgagctg
ttcggccaaggccgcatgtcacttacagaaattctgaacaaagtcgacgacagcgcaagc
gagaaagcagccaaagcactggatgaaaaagaaccgtacgacgtactcgttgtaggtggc
ggccctggtggtagtgcagcagcgctttacgcagcacgtaaaggcatccgcactggtgtt
gtggctaaacgttttggtggtcaggttatggacaccatggcgatcgaaaactttgtttcg
gtgaaacgcactgaaggccctaagctggcggctgatctaggcgagcatttgaaagagtac
gacgttgacgttgtgacagagcaacaagctaaaaagctaatgggcgcagcacatactgaa
gatggtcttatccacattcagttagaaagtggcgcaacgcttaagagtcaaagtgttatt
ttgagcccaggtgctcgctggcgtgaaatgaatgttcctggtgagcaagagtaccgtaat
aaaggcgttgcatactgcccacactgtgatggaccgctattcaaaggtaaaaagacggct
gttatcggtggcggtaactcaggtatcgaagcggcaatcgaccttgcaggtattgtggag
catgtaacggttcttgaatttgctgatgttttacgtgctgaccaagtactgatcaacaaa
gcgaactcgctaccaaacgttgacatcattaccatggcacaaacaacggaagttgtaggt
gacggcaagcgcgtgactggcctgaaatacaaagaccgcaacacagatgaaatcaaagaa
cttgagctatcgggtatcttcgttcaaatcggtcttgttcctaacacagagtggctgaaa
gattcagatgtgaacttgtctccacgcggtgaaattgaagtaggcagtcacggtgaaacc
agcctagaaggtgtatttgctgcgggtgacgcaacaacggttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcgtttgactacctgattcgtaag
caaggttaa

DBGET integrated database retrieval system