KEGG   Virgibacillus necropolis: CFK40_00260Help
Entry
CFK40_00260       CDS       T04976                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vne  Virgibacillus necropolis
Brite
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFK40_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASN07248
UniProt: A0A221MHW2
LinkDB All DBs
Position
complement(48669..49157)
Genome map
AA seq 162 aa AA seqDB search
MYYPVRQRVSRAYAEVQGSALAPDLYGYVVFTDVPYGTEVMVEVSGLPPYQPAQGDQAPI
GPHGFHIHQHADCGSADKPEPFQEAGGHWNPTNQPHGNHAGDFPVLFSNNGYARMSFFTN
AFSVEDVIGHSVMIHQNPDDYRSQPSGDAGKRIGCGPIMALQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagtaagacaaagggtatcaagagcgtatgcagaggtacaaggtagtgca
ttagccccggatttatacggttatgttgttttcacagacgttccttatggtacagaagta
atggtggaagtatcaggactcccaccataccaaccagcacaaggggatcaagcgccgata
ggaccgcatggctttcatattcatcaacatgctgattgcggaagtgcagataagccggag
cccttccaagaggcaggtgggcactggaatccgactaatcagccacacgggaatcatgca
ggcgattttccagttctattttcgaataatggttatgctagaatgtcattttttacaaat
gcatttagtgtagaggatgttattgggcattcagtcatgattcatcagaatcctgatgat
tatcggtcacagccttcgggggatgctggaaaacggataggctgcggtccgataatggca
cttcaataa

DBGET integrated database retrieval system