KEGG   Virgibacillus necropolis: CFK40_05865Help
Entry
CFK40_05865       CDS       T04976                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
vne  Virgibacillus necropolis
Pathway
vne00040  Pentose and glucuronate interconversions
vne00051  Fructose and mannose metabolism
vne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFK40_05865
   00051 Fructose and mannose metabolism
    CFK40_05865
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CFK40_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASN04571
UniProt: A0A221MAB6
LinkDB All DBs
Position
1277289..1278320
Genome map
AA seq 343 aa AA seqDB search
MKALVKTELGFGNLEIQDKKEPQAGKNQVKIEVKYAGICGSDIHTYEGHYKVGVPVTLGH
EFSGEVVEVGEGVTEFKPGDRVTSETTFYICGDCDYCKAGDYNLCNHRKGLGTQQDGGFT
KYLIARKGSVHKLPENVDYQSAAMTEPLACTHHAVSKTEINQGDIVVVIGPGPIGLFTAQ
VAKSRGAIVLITGLTNDKVRLDKAKELGIDYAVDTQKQDIKELVNSLTNGYGADVVFECS
GAVPAAKQGLDLLRKKGQYGQVGLFAQPEIQFDLEKIIQKEIRVVGSRSQKSADWEPSLE
LMNNGSVNAKAMVTHEFDIAEWDAAYQAIKSGEAIKVLLTPVE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttagtaaaaacagaactcggatttggtaatttagaaattcaagataaaaaa
gaaccgcaagccggtaaaaaccaagtgaaaattgaagtgaaatatgcaggtatctgcgga
tccgatattcatacctatgaaggccattacaaggtgggagtacctgttacattaggacat
gaattttctggtgaggtggtggaagtcggtgaaggtgttacggaatttaaacctggtgac
cgtgttacatcagaaactactttctatatttgcggggattgtgactattgtaaagctggc
gactacaacttatgtaatcatcgaaagggactaggaacacagcaggatggaggcttcacc
aaatatttaatcgcacgtaagggaagtgtccataagctcccggaaaatgtggattatcaa
tcagcggcaatgacagaaccattagcatgtacacatcatgctgtgtccaaaacagaaatt
aaccaaggcgacattgttgttgttattggtccaggcccaattggattatttactgcacag
gttgctaaaagccgaggtgctatcgttctaattactggtttaaccaatgacaaggtacgt
ttggataaggcaaaagaattaggtatcgactatgcagttgatactcaaaaacaagatatt
aaggaacttgttaatagcttaacaaacggatatggtgcagatgttgtatttgagtgttct
ggtgcggttcctgcagcaaaacaaggacttgacttattacgtaaaaaaggacaatacggt
caagttggactttttgctcaaccagaaattcaattcgatcttgaaaaaatcattcaaaaa
gaaattcgtgttgttggaagtagaagccaaaaatctgcagactgggaaccatcgcttgaa
ttaatgaataatggcagtgtaaatgccaaagcaatggtaacgcacgaatttgatattgca
gagtgggacgcggcataccaggcaattaagagtggggaagcaattaaggtactattaact
ccagtagaataa

DBGET integrated database retrieval system