KEGG   Virgibacillus necropolis: CFK40_09440Help
Entry
CFK40_09440       CDS       T04976                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vne  Virgibacillus necropolis
Brite
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CFK40_09440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASN05220
UniProt: A0A221MC81
LinkDB All DBs
Position
2007473..2008084
Genome map
AA seq 203 aa AA seqDB search
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNGALEGHDDLQAKSIEDLVA
SLDSVPENIRTAVRNNGGGHANHSLFWKVLSPNGGGEPSGELADKINNKFGSFDKFKEEF
EEAAKTRFGSGWAWLVVNNGELEVTSTPNQDNPLADGKTPVLGLDVWEHAYYLKYQNKRP
EYASAFWNVVNWDEVAKNYNEAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattaccagaattaccgtatgcatacgatgctttagaaccaacaatt
gataaggaaacaatgaacatccaccatacgaagcatcacaatacttatgttacaaaatta
aatggtgctttagaaggacacgatgatcttcaagccaaatctattgaagatttagttgca
agtcttgattctgtaccagaaaacattcgtactgctgtccgtaacaatggtggcggtcat
gcgaatcatagcttattctggaaagttctttcaccaaacggtggcggtgaaccttctggc
gaattagctgataaaattaacaataaatttggtagctttgataaatttaaagaagaattt
gaagaagcagccaagactcgttttggatctggttgggcatggctagtagttaataatggc
gaacttgaagttacaagtactccaaatcaggacaaccctttagctgatggtaagactcca
gttttaggactagatgtttgggagcatgcttattaccttaaatatcaaaacaagcgccca
gaatatgcttcagcattctggaatgtagttaactgggatgaagttgcaaaaaactataac
gaagcaaaataa

DBGET integrated database retrieval system