KEGG   Virgibacillus necropolis: CFK40_17260Help
Entry
CFK40_17260       CDS       T04976                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vne  Virgibacillus necropolis
Pathway
vne00010  Glycolysis / Gluconeogenesis
vne00053  Ascorbate and aldarate metabolism
vne00071  Fatty acid degradation
vne00280  Valine, leucine and isoleucine degradation
vne00310  Lysine degradation
vne00330  Arginine and proline metabolism
vne00340  Histidine metabolism
vne00380  Tryptophan metabolism
vne00410  beta-Alanine metabolism
vne00561  Glycerolipid metabolism
vne00620  Pyruvate metabolism
vne00625  Chloroalkane and chloroalkene degradation
vne01100  Metabolic pathways
vne01110  Biosynthesis of secondary metabolites
vne01120  Microbial metabolism in diverse environments
vne01130  Biosynthesis of antibiotics
Module
vne_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFK40_17260
   00053 Ascorbate and aldarate metabolism
    CFK40_17260
   00620 Pyruvate metabolism
    CFK40_17260
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFK40_17260
   00561 Glycerolipid metabolism
    CFK40_17260
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFK40_17260
   00310 Lysine degradation
    CFK40_17260
   00330 Arginine and proline metabolism
    CFK40_17260
   00340 Histidine metabolism
    CFK40_17260
   00380 Tryptophan metabolism
    CFK40_17260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFK40_17260
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFK40_17260
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFK40_17260
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CFK40_17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ASN06644
UniProt: A0A221MG87
LinkDB All DBs
Position
complement(3628243..3629667)
Genome map
AA seq 474 aa AA seqDB search
MRNQLKHYINGEWVESTGTDTEEVINPATEEVMGKISLGTKEDLDKAVEAARVALPSFSQ
TTKEERIKMLEKITAEYEKRKEDLIETMTDELGAPLNISEKVHYQMGYAHFSQAAKSLKE
FSFTEDRGDHTIVKDTVGVSGLITPWNFPTNQTSTKIASAFAAGSPVVLKPSELTPFAAI
ILAEIFDAAGVPKGVFNLVNGSGSVIGDGISSHPDIDFVSFTGSVGTGQKIMENAAKTIK
NFALELGGKSPLVVLEDADIEQAAKAAVNHIAMNTGQVCSAATRIIVPASIKEEFEEAVK
NVLPKFPVGDPREKSFIGPLVAKKQWDTVQSYIEKGISEGATLIAGGTGKPEGIEKGYYA
RPTIFTDVINNMVIAQEEIFGPVMSIITYETVDEAIEIANDTVYGLAGYVIGNDNETLRK
VATSIKAGRVTVNNAGADFSAPFGGYKQSGIGREWGDFGIEEYLETKAILGLSS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaccaattgaaacattatattaatggcgaatgggtagaatcaaccggcactgat
acggaagaggtcattaacccagcaacagaagaagtaatggggaaaatcagtctaggtact
aaagaagatttggataaggcagtagaagctgcacgagtagcgcttccttctttttcacaa
acaactaaagaagaacgaataaaaatgcttgagaagattaccgctgaatatgaaaaacgt
aaagaggatctcattgaaaccatgactgatgaactaggagcaccgcttaatatttcagaa
aaggttcactatcaaatgggctatgcgcatttttcgcaagctgcaaaatcacttaaagag
ttttcatttaccgaggatcgtggtgaccatacaattgtaaaggatacagtaggtgttagt
gggcttattacaccatggaactttccaacaaatcaaacgtcaaccaagattgcaagtgca
tttgcagcaggaagcccagttgtgttaaaaccatctgaattgacaccatttgctgcgatt
attttagcggagatttttgatgctgctggcgttcctaaaggtgtctttaaccttgttaat
ggttcaggttctgtgattggggatggtattagttctcatcctgacattgatttcgtttcc
tttacaggctctgttggcactgggcaaaagattatggaaaatgcagccaagacaattaag
aacttcgcgcttgagctaggagggaaatcccctctggttgtactagaggatgcagatata
gaacaagcggctaaagcagctgttaatcatattgcaatgaatacgggtcaggtttgctct
gcggctacacgcattattgtacctgcttctattaaggaagaatttgaagaagcggtcaag
aacgtgctaccaaaattccctgttggtgaccctcgtgagaagtcattcataggtccactc
gttgctaaaaaacaatgggatactgttcagtcttatatcgaaaaaggaattagtgaaggt
gcaacccttattgctggtggtactggtaagccagaaggtattgaaaaaggatactatgct
cgaccaactatttttacagatgttataaacaacatggtcatcgcgcaggaagaaattttt
ggaccagtaatgtccattatcacgtacgaaacggtcgacgaagcaattgaaattgcaaat
gacaccgtgtacggactagctggttatgtgattggaaatgataatgaaacattacgtaaa
gtagcaacaagtataaaagctggtcgagtaactgtcaataatgctggggcagacttctct
gcaccgtttggtggctataagcaatctggtatcggaagagaatggggcgatttcggtatt
gaagaatacctcgaaacgaaagctatcttaggtctttcatcataa

DBGET integrated database retrieval system