KEGG   Virgibacillus necropolis: CFK40_18810Help
Entry
CFK40_18810       CDS       T04976                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
vne  Virgibacillus necropolis
Pathway
vne00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:vne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFK40_18810
Enzymes [BR:vne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CFK40_18810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ASN06916
UniProt: A0A221MGY6
LinkDB All DBs
Position
complement(3962971..3964470)
Genome map
AA seq 499 aa AA seqDB search
MVETLLQVKKLANYIGGEWIEAKGETTPVINPATGETVVEVPLSDASSVDDAVKAAKKAQ
KEWALVPAPMRAEVLYRVGSIMKERKERLSQLLTMENGKVIEEARGEVQEGIDMAFYMAG
EGRRMFGQTTPAELKDKFAMSVRAPIGVVGLITPWNFPIAIATWKSFPAIVAGNGVVWKP
ATETPIMAFELAKIFEEAGLPKGVVNVVFGSGSAVGNAMVNHDGIRVISFTGSNDTGRKI
AAQCGQQLKKVSLEMGGKNAVIVMDDADLTLAVEGILWSAFGTSGQRCTACSRVIVHEKV
KDELENRLLEEMKKLSIGNGLDESIKVGPIINKAGIDKIKKYMEIGKEEGAELLAGGYVM
DDGEHKQGNYFAPTLFSNVKPDMRIAYEEIFGPVVSLIPVKSFEEAVEVNNSVEYGLSSS
IFTSDVNQVFKAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVQALDVFTEW
KAVYVDYSGKLQRAQIDVE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaacactattacaggtaaaaaagctagcaaactatatcggtggagaatggatt
gaggcgaaaggggaaacaacacctgtcattaatccagcaacaggtgaaaccgtggtagaa
gtcccgctttcggacgcatctagtgttgatgatgcagtgaaggcagccaaaaaggcacaa
aaggaatgggcactagttccggcacctatgcgagctgaagttttataccgtgtaggaagc
ataatgaaagagcgcaaagagcgtctttctcaattattaacaatggaaaatggaaaagta
atcgaggaagctcgcggagaagtccaagaggggatcgatatggcattttatatggctgga
gagggtcgtagaatgtttgggcaaacaacaccagcagagttgaaggataagtttgctatg
agtgttcgtgcaccaattggtgtagttggtttgattaccccgtggaactttccaattgca
attgcaacgtggaagtcatttccagcaatcgtggcaggaaatggggttgtatggaaacca
gcaacagaaacaccaataatggcatttgaacttgcgaaaatttttgaagaagctgggtta
ccaaaaggtgttgtaaatgtggtgttcggttcaggttcagctgtaggaaacgccatggtc
aatcatgatgggattcgggttatttcctttacagggtctaatgatacggggcgtaaaatc
gcagcgcaatgtggtcagcaattgaaaaaggtttcccttgaaatgggtggtaagaatgca
gtgattgtcatggatgatgctgatttaacattagctgttgaaggtattctttggagtgca
tttggaacgagtggccagcgttgtacggcgtgtagccgggtaattgtccacgagaaggtc
aaagatgaattagaaaacaggctactcgaggaaatgaaaaaattatcaattggaaatggt
ttggatgaatccataaaagtaggtcctattattaacaaagccggaatagataaaattaaa
aagtacatggagattggtaaagaagaaggcgctgagttattagctggtggctatgtaatg
gacgatggagagcacaaacaaggaaattactttgcaccaacattattttcaaatgttaaa
cctgatatgcgaattgcatatgaggaaatatttggccctgtcgtctcattgataccagtt
aaaagctttgaggaagcagtagaagttaacaatagtgtggaatatggactttctagttct
atttttacgagtgatgtaaatcaagtgtttaaagcgcagcgtgacctagacacaggtatt
gtctatgtgaatgcaggaactactggagcggagattcatttaccatttggtggtacaaaa
ggaactggaaatgggcaccgcgattctggtgttcaagccttagatgtatttactgaatgg
aaagcggtatacgttgattacagtgggaaattacagcgcgctcaaatcgatgtggaatag

DBGET integrated database retrieval system