KEGG   Vibrio nigripulchritudo: VIBNI_A0837
Entry
VIBNI_A0837       CDS       T02871                                 

Definition
(GenBank) putative SENSORY TRANSDUCTION HISTIDINE KINASE
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VIBNI_A0837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vni01001]
    VIBNI_A0837
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vni02022]
    VIBNI_A0837
Enzymes [BR:vni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VIBNI_A0837
Protein kinases [BR:vni01001]
 Histidine kinases
  OmpR family
   VIBNI_A0837
Two-component system [BR:vni02022]
 OmpR family
  RstB-RstA
   VIBNI_A0837
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_3 HAMP HATPase_c_5 HATPase_c_2
Other DBs
NCBI-ProteinID: CCO57005
UniProt: U4JVV6
LinkDB
Position
1:complement(891927..893579)
AA seq 550 aa
MIKAFSILWLVILIPIALVFSPFGSVPLNEIGNSMAHKFYTEVYGPTLYTLEDDLLKLPK
EEWKSYSDELQPEFGHKLDVVSIVDFPFTDSNKALISDGEMIYHIGDPPALMKRVGESDQ
AVYFAVELAVHEAGKMAAKGPLHLLRRQILELPKEQREEGLRKLTETLPVIATFEKIDSV
KLSEEEQKKLLAGEIAAELSENDEIVFYALIEEGIVLKIFEHNSTKLQLQFSSYIIMGIM
ACIAAGMFLWAIPLWRDLKRLAATTNAYGRGELQSRAKISRMSVVAQLSGSFNKMADNIE
KLILGHRELTNAIAHDLRTPLYRLRFAFEMLNDNKLSDEQRAKYNGVVEKSIDDLDHLIN
QTLILSRYSRVPSAEQIAPCILEPVLRSEINHFQLEHPELSVSFQCSSLLKESEVMVDQR
AMIRALNNLLANAARFAEETIQVTLERHPNNWVLIVEDDGIGIPQDMWQSIFDPFTQVNN
EQRDTSTGHGLGLAIVKQIAHWHEGEANVSQSELGGAKFIITWNKPLTSDSPNQAQAVTN
RHISSTSEHG
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgataaaagcattttcaatactttggctggtcattctgattcctatcgcgcttgtattc
agtccatttggttctgtacctctcaatgagattggcaacagcatggcgcacaaattttat
accgaagtctacggtcccacactatacactctcgaagatgatcttctcaaactgcccaaa
gaagaatggaaaagttattctgacgaacttcaacctgaattcggtcacaaattggatgtg
gtctcgattgttgattttcccttcacagattcgaacaaagcactcatcagtgacggtgaa
atgatttatcacattggtgacccacccgcgctaatgaaacgcgttggagaaagcgatcag
gcggtttattttgcagtagagttagctgtccatgaagccggaaaaatggccgcaaaaggt
ccacttcatttgctgagaagacagatactggagttgccaaaagagcagcgtgaagaaggg
cttcgtaaactcaccgagactttgcctgttatcgccacttttgaaaaaatcgatagcgtt
aaactatctgaagaagaacagaaaaagcttctggcgggtgaaatagccgcagagctcagc
gaaaatgacgagattgttttttatgcgctaatcgaagagggaattgtgctcaaaattttc
gagcataactcgactaagctgcagttacagttctcaagttacatcatcatgggcatcatg
gcttgcatagccgctggtatgttcctgtgggccatacctctgtggcgagatctgaaaagg
ttagcggcaaccaccaatgcatatggaagaggtgagcttcagtcccgagccaaaatttcc
cgtatgtctgtagtcgcgcagttaagtggttctttcaacaaaatggcagacaatattgag
aagttaatattgggtcacagagaactgaccaatgccattgcacacgatttaagaacacct
ctttaccgtctgcgttttgcttttgaaatgctgaacgataacaaactcagtgacgagcaa
agagcaaaatataacggggtagtcgagaaaagtatcgatgatctggaccacctgattaac
caaaccttaattttgtctcgctactctcgagtgccgagcgctgaacaaatcgccccttgc
atacttgagccggttttacgctctgaaatcaatcactttcagttggagcaccctgagctc
tccgttagttttcaatgctcttcattgctgaaggaaagcgaagtcatggtggatcaacga
gccatgatacgagctctgaacaacttgctcgccaatgcggctcggtttgcagaagaaacc
attcaggtgacacttgagcgtcacccaaacaactgggtactcattgttgaagatgacggg
attggtatacctcaagatatgtggcagtccatcttcgatccctttacccaagtcaataat
gaacagcgagatacaagcacagggcatggattaggtctggcaatagtcaaacagattgcg
cattggcacgaaggcgaagctaacgtatcacaatctgaattaggtggtgcgaaattcatc
atcacctggaataagcccttaacaagcgattcaccaaaccaagcacaagcggtcacaaac
cgtcacatttcgtctacaagtgagcatggatga

DBGET integrated database retrieval system