KEGG   Vibrio nigripulchritudo: VIBNI_A0859Help
Entry
VIBNI_A0859       CDS       T02871                                 

Definition
(GenBank) putative NTP pyrophosphohydrolase including oxidative damage repair enzyme
Organism
vni  Vibrio nigripulchritudo
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: CCO57026
UniProt: U4K386
LinkDB All DBs
Position
1:916235..916723
Genome map
AA seq 162 aa AA seqDB search
MEHRIRAAGILIEDDKILLVRVKDHTGVYWIPPGGGMENEDATTKDALRREFREETNLRV
KVGDLICVREFQEQHPLRYHAEFFYLIESYEGEPSKENLIGLNDQEYIQDVEWVRLDTIK
NLRVYPAELKSTLIEDAINKRFSTHLGSYVQGENESKNWLEA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaacacagaatccgagctgcaggcattcttatcgaagatgacaagattctcctggtg
agagtcaaagatcatacaggcgtttattggatcccacccggtggtggaatggaaaatgaa
gacgccactactaaagatgcgctgcgtcgagagtttcgtgaagagaccaacttacgagta
aaagtgggcgacttgatatgtgtgcgagagtttcaggagcaacacccactgcgttatcac
gctgagtttttctatctgattgaaagctacgaaggcgagccgagcaaagaaaaccttatc
ggtttaaacgatcaggaatacatccaagatgtcgaatgggtaaggctagacaccatcaaa
aacctcagagtttacccagcggagctgaaaagtaccttgattgaagatgccatcaacaaa
cgctttagcacccaccttggcagctatgttcaaggggaaaacgaatccaagaactggctt
gaggcgtaa

DBGET integrated database retrieval system