KEGG   Vibrio nigripulchritudo: VIBNI_A0892Help
Entry
VIBNI_A0892       CDS       T02871                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vni  Vibrio nigripulchritudo
Brite
Enzymes [BR:vni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VIBNI_A0892 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCO57055
UniProt: U4JW00
LinkDB All DBs
Position
1:complement(956297..956881)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLLPGTEFENKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINASFGSFDEFKAKFTDSAINNFG
SSWTWLVKKADGSLDIINTSNAATPLTEEGITPLLTVDLWEHAYYIDFRNVRPDYMGAFW
ALVNWEFVAANLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcaaaagacgcgctagaaccgcacatctct
gcagaaactctggattttcaccacggcaagcaccacaacacttacgttgttaagttgaac
ggtctgctaccaggtacagagtttgaaaacaagtctttggaagagatcatcaaaacttct
actggcggcgtatttaacaacgcagcacagatctggaaccacacgttttactggcactgc
ctggcaccaaacgcaggtggcgaaccaacaggtgcagtagctgacgctattaacgcatct
ttcggttcattcgacgagttcaaagcgaagtttacagattcagcaatcaataacttcggt
tcgtcttggacatggcttgtgaaaaaagcggacggttctttagacatcatcaacacgtct
aacgctgcaacaccactaacagaagaaggcatcacgccactacttactgttgatttgtgg
gaacacgcttactacatcgatttccgcaacgttcgtccagactacatgggcgcgttttgg
gcattggtgaactgggaatttgttgcggctaacctggcaaaataa

DBGET integrated database retrieval system